Detailed information of component protein


Summary

Component ID T6CP002544
Component protein type TssA
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (398 a.a.); Nucleotide sequence (1194 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07420
Coordinate (Strand) 1624645..1625838 (-)
NCBI ID WP_011192713.1
RefSeq NC_010465
Uniprot ID A0A0H3B1T5_YERPY, A0A0U1R0N3_YERP3, A0A3G5JXC5_YERPU, Q668R3_YERPS
KEGG ID ypr:BZ20_3535, ypi:YpsIP31758_1359, ypc:BZ23_2255, ypo:BZ17_3964, yps:YPTB2674, ypy:YPK_1471, ypq:DJ40_3869, ypu:BZ21_1971
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpA_N PF06812.14 1.3e-29 17..140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-397 MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKCLELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELEDIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALLQGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAEVQTVAETQMAIPIEAPQQRQAVVTPSPPLQPLQLQSAQLQPVPIQSPPVPVQQQGIQNRADALARLIEVREWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9886 - -



  Protein sequence: 398 a.a.    

>T6CP002544 NC_010465:c1625838-1624645 [Yersinia pseudotuberculosis YPIII] [TssA]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKCLELLNNSRDI
RLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELEDIDGFIADFRNQQLPKAAGV
QLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALLQGLATRLNNSLGEDTPDFVRMTSVLRHFDA
AITPIAPIVVPEPIETPDVVELYPVATAMLASTEMPVTAEVQTVAETQMAIPIEAPQQRQAVVTPSPPLQPLQLQSAQLQ
PVPIQSPPVPVQQQGIQNRADALARLIEVREWFTAMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE*

  Nucleotide sequence: 1194 bp    

>T6CP002544 NC_010465:c1625838-1624645 [Yersinia pseudotuberculosis YPIII] [TssA]
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACTTTCCTTGTGG
CAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAGCCTAAGCAGGCCGCTGAATACGGCAATT
TTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGCCTTGAACTCCTGAATAATTCTCGGGATATT
CGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGGTCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACT
TTGGTGCCTCGACACTTGGCCTGATCAGCTACATCCTCAGCTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTA
ATGCTTTTGCTGAACTGGAAGACATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTG
CAACTTTCCATCAAAGAGTTTGAAAAGGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTCAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTTTCACTCCAGCACGCTTATGCCTTGTTGCAAGGATTAG
CCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCGGTGTTACGCCACTTTGATGCC
GCGATAACCCCGATAGCGCCTATCGTGGTGCCAGAACCTATTGAGACCCCAGACGTTGTCGAGCTCTATCCGGTCGCCAC
AGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAGGTACAGACGGTTGCAGAGACACAAATGGCCATACCCATTG
AGGCTCCCCAACAGCGTCAAGCGGTGGTAACCCCATCCCCGCCGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAA
CCTGTACCGATACAGTCGCCGCCGGTGCCTGTCCAACAGCAGGGGATCCAAAACAGGGCTGATGCGTTAGCCCGGCTTAT
AGAGGTGCGAGAGTGGTTTACCGCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCG
GCAAAAGCTTCGGCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGAGTAA