Detailed information of component protein
Summary
| Component ID | T6CP002245 |
| Component protein type | TssJ |
| T6SS ID (Type) | T6SS00225  (Type i3) |
| Strain | Yersinia pseudotuberculosis IP 31758 |
| Replicon | chromosome |
| Sequence | Protein sequence (164 a.a.); Nucleotide sequence (492 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 3857218..3857709 (-) |
| NCBI ID | WP_011191717.1 |
| RefSeq | NC_009708 |
| Uniprot ID | A0A0E8XF05_9GAMM, Q66EN9_YERPS, A0A0U1QY58_YERP3, A0A3G5KES3_YERPU |
| KEGG ID | yps:YPTB0653, ypq:DJ40_1716, ypu:BZ21_4035, ypi:YpsIP31758_3424, ypr:BZ20_1442, ypo:BZ17_1904 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-4 | MRSL |
| Transmembrane helix | 5-27 | FRVLPIFILTGCVLLSGCSWFSS |
| Inside | 28-163 | SSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLMLKSDARADFNRVVLVDGKALSLKASTK |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| LIPO(Sec/SPII) | 0.9985 | pos: 21-22. LSG-CS. | MRSLFRVLPIFILTGCVLLSG |
Protein sequence: 164 a.a.
Nucleotide sequence: 492 bp