Detailed information of component protein


Summary

Component ID T6CP001611
Component protein type TssC
T6SS ID (Type) T6SS00164 experimental (Type i3)
Strain Acidovorax citrulli AAC00-1
Replicon chromosome
Sequence Protein sequence (500 a.a.); Nucleotide sequence (1500 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AAVE_RS07340
Coordinate (Strand) 1634081..1635580 (+)
NCBI ID WP_011794618.1
RefSeq NC_008752
Uniprot ID A1TM80_ACIAC, A0A2R4EVB2_9BURK
KEGG ID aav:Aave_1477
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 1.7e-137 68..370
VipB_2 PF18945.2 1.1e-45 380..491

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-499 MNTTTSLDAVQGTQTLEGSEFTSLLQKEFKPKTDQAREAVESAVQTLAQQALAASATLSDDAYQTVQAIIAEIDRKLSEQINLIIHHSDFQQLEGAWRGLHHLVHNTEVDELLKIRVMNISKKELHRNMRRFKGVGWDQSPIFKKVYEEEYGQFGGEPFGCLVGDYYFDHSPPDVELLGEMAKVSAAAHCPFIAGASPAMMQMDSWQELANPRDLTKIFTNTEYAAWRSLRDSDDSKYIGLAMPRFLARLPYGAKTNPVDEFDFEEETAGGDHSKYAWANSAYAMAVNINRSFKYYGWCTSIRGVESGGAVDNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDVAAFIGAQSLHKPAEYYDPDATANANLSARLPYMFACCRFAHYLKCIVRDKIGSFKERSDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVAEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKLPSVKQAGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9530 - -



  Protein sequence: 500 a.a.    

>T6CP001611 NC_008752:1634081-1635580 [Acidovorax citrulli AAC00-1] [TssC]
MNTTTSLDAVQGTQTLEGSEFTSLLQKEFKPKTDQAREAVESAVQTLAQQALAASATLSDDAYQTVQAIIAEIDRKLSEQ
INLIIHHSDFQQLEGAWRGLHHLVHNTEVDELLKIRVMNISKKELHRNMRRFKGVGWDQSPIFKKVYEEEYGQFGGEPFG
CLVGDYYFDHSPPDVELLGEMAKVSAAAHCPFIAGASPAMMQMDSWQELANPRDLTKIFTNTEYAAWRSLRDSDDSKYIG
LAMPRFLARLPYGAKTNPVDEFDFEEETAGGDHSKYAWANSAYAMAVNINRSFKYYGWCTSIRGVESGGAVDNLPAHTFP
TDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSDVAAFIGAQSLHKPAEYYDPDATANANLSARLPYMFACCRFA
HYLKCIVRDKIGSFKERSDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVAEVEGNPGYYTSKFFLRPHYQLEG
LTVSLRLVSKLPSVKQAGN*

  Nucleotide sequence: 1500 bp    

>T6CP001611 NC_008752:1634081-1635580 [Acidovorax citrulli AAC00-1] [TssC]
ATGAACACGACGACTTCTCTGGACGCGGTGCAGGGCACCCAGACGCTCGAGGGCAGCGAATTCACCTCGCTGCTGCAGAA
GGAATTCAAGCCCAAGACCGACCAGGCGCGCGAGGCGGTCGAATCGGCCGTGCAGACGCTCGCGCAGCAGGCGCTGGCGG
CCTCGGCCACGCTGTCGGACGATGCATACCAGACCGTCCAGGCCATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAG
ATCAACCTGATCATCCACCACAGCGATTTCCAGCAGCTCGAGGGCGCATGGCGCGGCTTGCACCACCTGGTCCACAACAC
CGAGGTGGACGAGCTGCTCAAGATCCGCGTGATGAACATCTCCAAGAAGGAGCTGCACCGGAACATGCGCCGCTTCAAGG
GCGTGGGCTGGGACCAGAGCCCGATCTTCAAGAAGGTGTACGAAGAGGAATACGGCCAGTTCGGCGGGGAGCCGTTCGGG
TGCCTGGTGGGCGACTACTATTTCGACCACAGCCCGCCGGACGTGGAACTGCTCGGCGAGATGGCCAAGGTGTCCGCCGC
CGCCCACTGCCCGTTCATCGCCGGCGCGTCTCCCGCGATGATGCAGATGGACTCCTGGCAGGAGCTGGCCAACCCCCGCG
ACCTGACCAAGATCTTCACCAACACCGAATATGCCGCGTGGCGCAGCCTGCGCGATTCCGACGACTCGAAGTACATCGGC
CTGGCGATGCCGCGCTTCCTCGCGCGCCTGCCTTACGGCGCGAAGACGAATCCGGTGGACGAGTTCGACTTCGAGGAGGA
AACGGCCGGCGGCGACCACAGCAAGTACGCCTGGGCGAACTCCGCCTATGCGATGGCCGTGAACATCAACCGCTCGTTCA
AGTACTACGGCTGGTGCACCTCGATCCGCGGGGTGGAGTCCGGCGGCGCGGTGGACAACCTGCCGGCGCACACCTTCCCG
ACGGACGACGGCGGCGTGGACATGAAGTGCCCGACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAATTGGCCAAGAA
CGGCTTCATGCCGCTGGTGCACCGCAAGAACTCCGACGTCGCCGCCTTCATCGGCGCGCAGTCCCTGCACAAGCCGGCCG
AATACTACGATCCGGACGCCACGGCGAACGCCAACCTGTCGGCGCGCCTGCCCTACATGTTCGCGTGCTGCCGCTTCGCG
CACTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAAGGAGCGCTCCGACATGGAGCGCTGGCTCAACGACTG
GATCATGAACTACGTGGACGGCGACCCGGCCAACTCCTCGCAGGAAACCAAGGCCCGCAAGCCGCTGGCCGCGGCCGAGG
TGCAGGTGGCCGAAGTGGAAGGCAACCCGGGCTACTACACGTCCAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGC
CTGACCGTGTCCCTGCGGCTGGTGTCGAAGCTGCCGTCGGTGAAGCAGGCGGGCAACTGA