Detailed information of component protein


Summary

Component ID T6CP001605
Component protein type TssJ
T6SS ID (Type) T6SS00164 experimental (Type i3)
Strain Acidovorax citrulli AAC00-1
Replicon chromosome
Sequence Protein sequence (188 a.a.); Nucleotide sequence (564 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AAVE_RS07305
Coordinate (Strand) 1624635..1625198 (+)
NCBI ID WP_011794611.1
RefSeq NC_008752
Uniprot ID A1TM73_ACIAC
KEGG ID aav:Aave_1470
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 4.2e-33 48..153

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-11 MHREAMARKGF
Transmembrane helix 12-34 IRAGLAAAAAAWLLGGCGMISNL
Outside 35-187 NRPQEAPTAVPPAVFEIVADPGVNPDIHGTPKPILLRIYELRAAAAFDRASYLDLQDKDEAQLGADFVRREEILLQPGERRTIERKGSADVRTFAVFAGYRDLERSTWRATAGAPNSVEMRRRWWGLGETERLKPVQYRITVGKDAVKIQTAP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.7526 pos: 27-28. LGG-CG. MHREAMARKGFIRAGLAAAAAAWLLGG



  Protein sequence: 188 a.a.    

>T6CP001605 NC_008752:1624635-1625198 [Acidovorax citrulli AAC00-1] [TssJ]
MHREAMARKGFIRAGLAAAAAAWLLGGCGMISNLNRPQEAPTAVPPAVFEIVADPGVNPDIHGTPKPILLRIYELRAAAA
FDRASYLDLQDKDEAQLGADFVRREEILLQPGERRTIERKGSADVRTFAVFAGYRDLERSTWRATAGAPNSVEMRRRWWG
LGETERLKPVQYRITVGKDAVKIQTAP*

  Nucleotide sequence: 564 bp    

>T6CP001605 NC_008752:1624635-1625198 [Acidovorax citrulli AAC00-1] [TssJ]
ATGCATCGGGAAGCGATGGCACGGAAGGGATTCATCAGGGCGGGGCTCGCGGCCGCGGCGGCGGCATGGCTGCTGGGCGG
CTGCGGCATGATCAGCAACCTGAACCGCCCGCAGGAGGCCCCCACGGCCGTGCCGCCGGCCGTGTTCGAAATCGTCGCGG
ACCCTGGCGTCAACCCCGATATCCACGGCACGCCCAAGCCCATCCTGCTGAGGATTTACGAACTGCGCGCGGCGGCGGCT
TTCGACCGGGCAAGCTACCTGGACCTGCAGGACAAGGACGAAGCCCAGCTGGGGGCCGATTTCGTGCGGCGCGAGGAGAT
CCTGCTGCAGCCGGGCGAGCGGCGCACCATCGAGCGCAAGGGCAGTGCGGATGTCCGCACCTTCGCCGTGTTCGCAGGCT
ACCGCGACCTGGAGCGCAGCACCTGGCGCGCGACCGCGGGCGCTCCCAACTCCGTGGAGATGCGCCGCCGCTGGTGGGGC
CTGGGCGAAACCGAGCGGCTCAAGCCCGTGCAGTACCGCATCACAGTGGGCAAGGATGCGGTGAAGATCCAGACCGCTCC
TTAA