Detailed information of component protein


Summary

Component ID T6CP001604
Component protein type TssD
T6SS ID (Type) T6SS00164 experimental (Type i3)
Strain Acidovorax citrulli AAC00-1
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AAVE_RS07280
Coordinate (Strand) 1617808..1618290 (-)
NCBI ID WP_011794606.1
RefSeq NC_008752
Uniprot ID A1TM68_ACIAC
KEGG ID aav:Aave_1465
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 2.5e-35 6..135

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MSVDMFMKVEGASGESQDANHKSWTDIRSFTWGATQPNSMATGSGAGAGKVTFHDLNVVAKIDKAYPAVLKHCSSGKHLGQVEISMCKAGGTQIEFSKITLTDVLVTSVTVSGTDGSDAVLVNYAFQAAKIKTQYWEQTNQGGKGAESSAGWNIKENKEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9372 - -



  Protein sequence: 161 a.a.    

>T6CP001604 NC_008752:c1618290-1617808 [Acidovorax citrulli AAC00-1] [TssD]
MSVDMFMKVEGASGESQDANHKSWTDIRSFTWGATQPNSMATGSGAGAGKVTFHDLNVVAKIDKAYPAVLKHCSSGKHLG
QVEISMCKAGGTQIEFSKITLTDVLVTSVTVSGTDGSDAVLVNYAFQAAKIKTQYWEQTNQGGKGAESSAGWNIKENKEA
*

  Nucleotide sequence: 483 bp    

>T6CP001604 NC_008752:c1618290-1617808 [Acidovorax citrulli AAC00-1] [TssD]
ATGTCCGTCGATATGTTCATGAAGGTTGAAGGTGCCAGCGGCGAATCACAAGACGCCAACCACAAGAGCTGGACCGACAT
CCGCTCCTTCACCTGGGGCGCGACGCAACCCAACTCGATGGCCACGGGCAGCGGCGCCGGCGCCGGCAAGGTCACTTTCC
ACGACCTGAACGTCGTGGCCAAGATCGACAAGGCCTACCCGGCCGTGCTCAAGCACTGCTCCTCCGGCAAGCACCTGGGT
CAGGTGGAGATCTCGATGTGCAAGGCCGGCGGCACGCAGATCGAATTCAGCAAGATCACGCTCACCGACGTGCTGGTCAC
GAGCGTCACCGTCAGCGGCACCGACGGCAGCGATGCCGTCCTGGTGAATTACGCATTCCAGGCCGCCAAAATCAAGACCC
AATACTGGGAACAGACGAACCAGGGCGGCAAGGGTGCAGAAAGCTCGGCCGGCTGGAACATCAAGGAAAACAAAGAAGCC
TGA