Detailed information of component protein


Summary

Component ID T6CP001582
Component protein type TssE
T6SS ID (Type) T6SS00161 experimental (Type i3)
Strain Azoarcus olearius
Replicon chromosome
Sequence Protein sequence (161 a.a.); Nucleotide sequence (483 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AZO_RS19570
Coordinate (Strand) 4277194..4277676 (+)
NCBI ID WP_198407936.1
RefSeq NC_008702
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 4.5e-23 30..134

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-160 MQPALLDRLRDDAPDQRHEAKEARVLGRSQLREAVLRDLTWLLNAMRPPEREGVGVWPEVENSVLNYGMPCFSGETASSLDITDLERAIRDSLLRFEPRIIPGTLEVSTEQHENILDWHNVISVRISAQIWAQPVPLELLLRTQLDLESGLVEVRDINGY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9917 - -



  Protein sequence: 161 a.a.    

>T6CP001582 NC_008702:4277194-4277676 [Azoarcus olearius] [TssE]
MQPALLDRLRDDAPDQRHEAKEARVLGRSQLREAVLRDLTWLLNAMRPPEREGVGVWPEVENSVLNYGMPCFSGETASSL
DITDLERAIRDSLLRFEPRIIPGTLEVSTEQHENILDWHNVISVRISAQIWAQPVPLELLLRTQLDLESGLVEVRDINGY
*

  Nucleotide sequence: 483 bp    

>T6CP001582 NC_008702:4277194-4277676 [Azoarcus olearius] [TssE]
CTGCAGCCGGCGCTGCTCGACCGCCTGCGCGACGACGCGCCGGACCAGCGCCACGAGGCCAAGGAAGCGCGCGTGCTCGG
CCGCAGCCAGCTGCGCGAGGCGGTGCTGCGCGACCTCACCTGGCTGCTCAACGCGATGCGCCCGCCGGAGCGGGAGGGCG
TCGGGGTGTGGCCGGAGGTCGAGAACTCGGTGCTGAACTACGGCATGCCGTGCTTTTCCGGGGAAACCGCGTCCTCGCTC
GACATCACCGACCTCGAACGCGCAATCCGCGACTCGCTGCTGCGTTTCGAGCCGCGCATCATCCCCGGCACGCTCGAGGT
CAGCACCGAGCAGCACGAGAACATCCTCGACTGGCACAACGTGATCAGCGTGCGCATCTCGGCGCAGATCTGGGCGCAGC
CGGTGCCGCTCGAACTGCTGCTGCGCACCCAGCTCGACCTCGAAAGCGGCCTGGTCGAGGTGCGCGACATCAACGGCTAC
TGA