Detailed information of component protein


Summary

Component ID T6CP001485
Component protein type TssC
T6SS ID (Type) T6SS00152 experimental (Type i1)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (492 a.a.); Nucleotide sequence (1476 bp)
Reference
[1] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537
[2] Lesic B, Starkey M, He J, et al. Quorum sensing differentially regulates Pseudomonas aeruginosa type VI secretion locus I and homologous loci II and III, which are required for pathogenesis. Microbiology (Reading). 2009 Sep;155(Pt 9):2845-2855. doi: 10.1099/mic.0.029082-0. Epub 2009 Jun 4. PMID: 19497948
[3] Hachani A, Allsopp LP, Oduko Y, et al. The VgrG proteins are "à la carte" delivery systems for bacterial type VI effectors. J Biol Chem. 2014 Jun 20;289(25):17872-84. doi: 10.1074/jbc.M114.563429. Epub 2014 May 2. PMID: 24794869
[4] Jones C, Hachani A, Manoli E, et al. An rhs gene linked to the second type VI secretion cluster is a feature of the Pseudomonas aeruginosa strain PA14. J Bacteriol. 2014 Feb;196(4):800-10. doi: 10.1128/JB.00863-13. Epub 2013 Dec 6. PMID: 24317402
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PA14_RS17480
Coordinate (Strand) 3827587..3829062 (-)
NCBI ID WP_003087596.1
RefSeq NC_008463
Uniprot ID S0HYD9_PSEAW, V6AGV3_PSEAI, A0A1C7C610_PSEAI, A0A0H2Z9C1_PSEAB, Q9I367_PSEAE, A0A6N0KJL3_9PSED, A0A071LEA1_PSEAI, A0A448BMY6_PSEFL
KEGG ID pae:PA1658, pau:PA14_43030
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 1.8e-130 65..364
VipB_2 PF18945.2 2.7e-44 378..488

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-491 MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAEIDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYKHIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKDLKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAFGTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRKGSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLELELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDKE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9726 - -



  Protein sequence: 492 a.a.    

>T6CP001485 NC_008463:c3829062-3827587 [Pseudomonas aeruginosa UCBPP-PA14] [TssC]
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAEIDAKLSTQMD
EILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYKHIYTAEYGQFGGQPVGAIIA
NYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKDLKDHFEGPQFAKWQSFRQSEDSRYVALTVP
RFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAFGTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEI
ETKIPTEVLVSDRREYELAEEGFISLTMRKGSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHY
LKVLQREQLGSWKERTDLELELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADF
TLSLVGKLDKE*

  Nucleotide sequence: 1476 bp    

>T6CP001485 NC_008463:c3829062-3827587 [Pseudomonas aeruginosa UCBPP-PA14] [TssC]
ATGAGCACCAGTGCCGCACAGCAAGGCCGGAACCAGAACGGCGAATACAACATTCTCGACAGCATCATCGCCGAGACCCG
CCTGAGCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTCTCCGCCTTCATCGAGGAATTGCTCAAGCCGCAGA
ACGACGGCGAGCCGGTGAAGAAGGCGATGGTCGACCGGATGATCGCCGAGATCGATGCCAAGCTCAGCACGCAGATGGAC
GAGATCCTCCATCATCCCGATTTCCAGGCGCTGGAGTCGGCCTGGCGCGGCCTGCAACTGCTGGTCGACCGCACCAACTT
CCGCGAGAACATCAAGATCGAGATTCTCAGCGTTTCCAAGCAGGACCTGCTGGACGATTTCGAGGACTCGCCCGAGGTGA
TGCAGTCCGGCCTGTACAAGCACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCATCGCC
AACTACTACATGTCGCCCAGTTCGCCCGACGTCAAGCTGATGCAATACGTCTCCAGCGTGGCCTGCATGGCCCATGCGCC
GTTCGTGGCGGCCGCCGGTCCGAAGTTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGACCTGAAGGATC
ATTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCCCGCTACGTGGCGCTGACCGTACCG
CGCTTCCTGCTGCGCACGCCCTACGATCCGGAAGAGAATCCGGTCAAGTCGTTCGCCTACAAGGAGACCGTGGCCAATAG
CCATGAGCATTACCTGTGGGGCAACACCGCCTATGCCTTCGGCACCAAGCTGACCGACAGCTTCGCCAAGTATCGCTGGT
GCCCGAACATCATCGGGCCGCAGAGCGGCGGTGCGGTGGAGGACCTGCCTTTGCACCACTTCGAGAGCATGGGCGAGATC
GAGACCAAGATCCCCACCGAGGTGCTGGTGTCCGATCGCCGCGAGTACGAACTGGCCGAGGAAGGCTTCATTTCCCTGAC
CATGCGCAAGGGCAGCGACAACGCCGCGTTCTTCTCCGCCAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCCG
AAGGCAAGGCCGCGGAGCTGAACTACAAGCTCGGCACCCAGTTGCCGTACATGATGATCGTCAACCGCCTGGCCCATTAC
CTGAAGGTCCTGCAACGCGAACAGCTGGGGTCGTGGAAGGAGCGTACCGACCTCGAGCTGGAGCTGAACAAGTGGATCCG
CCAGTACGTCGCCGACCAGGAAAACCCCAGCGCCGAAGTGCGCGGCCGTCGCCCGCTGCGCGCTGCACAGATCATCGTCA
GTGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCAGCCTGAACGTGCGCCCGCACTTCAAGTACATGGGGGCGGACTTC
ACCCTGTCGCTGGTCGGCAAGCTGGACAAAGAGTAA