Detailed information of component protein


Summary

Component ID T6CP001474
Component protein type TssB
T6SS ID (Type) T6SS00151 experimental (Type i4a)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (182 a.a.); Nucleotide sequence (546 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PA14_RS13895
Coordinate (Strand) 3029164..3029709 (-)
NCBI ID WP_003089493.1
RefSeq NC_008463
Uniprot ID A0A1C7B7Q9_PSEAI, A0A0H2ZB54_PSEAB, Q9I1B4_PSEAE, A0A6N0KJ21_9PSED, A0A071KUX1_PSEAI, A0A448BL02_PSEFL, A6V5C1_PSEA7
KEGG ID pap:PSPA7_2896, pau:PA14_34070, pae:PA2365
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 8.6e-54 10..160

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-181 MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNEILSSISPRATLQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDDLDQLLQDVVANTEGLQEIKAARPEAEAAPAGDSEPPADQPA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9974 - -



  Protein sequence: 182 a.a.    

>T6CP001474 NC_008463:c3029709-3029164 [Pseudomonas aeruginosa UCBPP-PA14] [TssB]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNEILSSISPRAT
LQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDDLDQLLQDVVANTEGLQEIKA
ARPEAEAAPAGDSEPPADQPA*

  Nucleotide sequence: 546 bp    

>T6CP001474 NC_008463:c3029709-3029164 [Pseudomonas aeruginosa UCBPP-PA14] [TssB]
ATGGCCGAGAGTACGCAGCACAAGCTGGACCGGGTGCGCCCGCCGCGCGTGCAGATCACCTACGACGTCGAGATCGGCAA
CGCCATCGAGAAGAAGGAGCTGCCCCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAAGCCGGATACCCCGCCGGCGA
AGCTGGTCGAACGGCGTTTCGTCGACATCGACCGCGACAACTTCAACGAGATCCTCTCCTCCATCTCTCCCCGCGCCACC
CTGCAGGTCGACAACACCATCAGCGGCGACGACAGCAAGCTGAACGTCGAGCTGCGCTTCAACCACATCGAGGACTTCGA
CCCGGTCAACCTGGTGAAGCAGGTGGTCCCGTTGCGTCGCCTGTTCGAAGCGCGCCAGCGCCTGCGCGACCTGCTGACCA
AGCTCGACGGCAACGACGACCTCGACCAGTTGCTGCAGGACGTGGTGGCCAACACCGAAGGCCTGCAGGAAATCAAAGCG
GCCCGCCCGGAAGCCGAAGCGGCCCCGGCCGGCGACAGCGAACCCCCGGCCGACCAGCCGGCCTGA