Detailed information of component protein


Summary

Component ID T6CP001227
Component protein type TssK
T6SS ID (Type) T6SS00126 experimental (Type i4b)
Strain Burkholderia cenocepacia AU 1054
Replicon chromosome I
Sequence Protein sequence (449 a.a.); Nucleotide sequence (1347 bp)
Reference
[1] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[2] Perault AI, Chandler CE, Rasko DA, et al. Host Adaptation Predisposes Pseudomonas aeruginosa to Type VI Secretion System-Mediated Predation by the Burkholderia cepacia Complex. Cell Host Microbe. 2020 Oct 7;28(4):534-547.e3. doi: 10.1016/j.chom.2020.06.019. Epub 2020 Aug 4. PMID: 32755549
[3] Loeven NA, Perault AI, Cotter PA, et al. The Burkholderia cenocepacia Type VI Secretion System Effector TecA Is a Virulence Factor in Mouse Models of Lung Infection. mBio. 2021 Oct 26;12(5):e0209821. doi: 10.1128/mBio.02098-21. Epub 2021 Sep 28. PMID: 34579569
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BCEN_RS13165
Coordinate (Strand) 2908276..2909622 (+)
NCBI ID WP_006477098.1
RefSeq NC_008060
Uniprot ID B4E6R0_BURCJ, A0A364GSZ1_9BURK, A0A3N8HNQ3_9BURK, A0A0H2XRS4_BURCA, A2VTE5_9BURK, B1JUN4_BURCC, A0A109ELU1_9BURK
KEGG ID bcm:Bcenmc03_0442, bcn:Bcen_2642, bcj:BCAL0338
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1e-140 19..446

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-448 MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFPDGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTDAAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDALQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMTFSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRSPLYERMLQAQSAMIYAPTGINDLKFELIAVTS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9971 - -



  Protein sequence: 449 a.a.    

>T6CP001227 NC_008060:2908276-2909622 [Burkholderia cenocepacia AU 1054] [TssK]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFPDGALYAAPQA
DDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTDAAEADITFLKTQVKLIAHSE
PRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDALQAKVNALYGFHREPSKNIIEFRSGDIASF
WLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMTFSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTR
YFAITLDEVRPSFHLGRLDSGKIDDKTEFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPA
IPVRPGACYFALDSRSPLYERMLQAQSAMIYAPTGINDLKFELIAVTS*

  Nucleotide sequence: 1347 bp    

>T6CP001227 NC_008060:2908276-2909622 [Burkholderia cenocepacia AU 1054] [TssK]
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGACAGGACGCGTACCA
CGAGGCGCGCCTGTTCGAGTCCATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTCGGTGCGCATCGACCGCGACG
CGCTCGGCAGCAACGTGCTGCGGGTCGCCGAGCTCGCGCTCGTGTTCCCGGACGGCGCGCTGTATGCCGCGCCGCAGGCA
GACGATCTGCCGCCGCCGATCGCGCTGGATACGTTGCCCGACGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCC
GCTGCGCGAGAACGGCACCAACTACAGCGACGATCCGGCCGCCGGCTTCATGACGCGGTTCGTCAGCGAGCAGACGAGCG
TTGCCGACAACTTCACCGACGCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAG
CCGCGCGACCAGCTGCTGTCGGTGCCGCTCGTGCGTGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCACTGCAGGCCA
AGGTGAACGCGCTGTACGGCTTCCACCGCGAACCGTCCAAGAACATCATCGAATTCCGTTCGGGCGACATCGCGTCGTTC
TGGCTGCTGCATACGGCGAACGCCGCATTCGCGACGCTCGCGCACCTGCACCAGCACGCGGCGCTGCATCCGGAGCGGCT
GTTCCAGGAACTGCTGCGCCTCGCGGGCCAGCTGATGACGTTCTCGAAGGGCTATACGCTCGCCGACCTGCCCGTGTACC
GTCACGACGACCCGGGCCCGAGCTTCGCGCGCCTCGACCTGATGCTGCGCGAACTGCTCGACACCGTGATCTCGACGCGC
TATTTCGCGATCACGCTCGACGAGGTGCGCCCGTCGTTCCACCTTGGCCGCCTCGATTCCGGCAAGATCGACGACAAGAC
CGAGTTCTACCTCGCGGTATCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGCTTCAAGGTCGGCG
CGCCTGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGTGCCGCCCGCG
ATTCCGGTGCGCCCCGGCGCGTGCTACTTCGCGCTCGATTCACGCAGCCCGCTGTACGAGCGCATGCTGCAGGCCCAGTC
CGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGATCGCGGTCACATCATGA