Detailed information of component protein


Summary

Component ID T6CP001225
Component protein type TssB
T6SS ID (Type) T6SS00126 experimental (Type i4b)
Strain Burkholderia cenocepacia AU 1054
Replicon chromosome I
Sequence Protein sequence (172 a.a.); Nucleotide sequence (516 bp)
Reference
[1] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[2] Perault AI, Chandler CE, Rasko DA, et al. Host Adaptation Predisposes Pseudomonas aeruginosa to Type VI Secretion System-Mediated Predation by the Burkholderia cepacia Complex. Cell Host Microbe. 2020 Oct 7;28(4):534-547.e3. doi: 10.1016/j.chom.2020.06.019. Epub 2020 Aug 4. PMID: 32755549
[3] Loeven NA, Perault AI, Cotter PA, et al. The Burkholderia cenocepacia Type VI Secretion System Effector TecA Is a Virulence Factor in Mouse Models of Lung Infection. mBio. 2021 Oct 26;12(5):e0209821. doi: 10.1128/mBio.02098-21. Epub 2021 Sep 28. PMID: 34579569
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BCEN_RS13150
Coordinate (Strand) 2905992..2906507 (-)
NCBI ID WP_006484395.1
RefSeq NC_008060
Uniprot ID A0A132F5X6_9BURK, U2FXG3_9BURK, A0A6J5EZP2_9BURK, A0A084D9C7_9BURK, A0A1K1SA47_9BURK, A0A1X1P833_9BURK, A0A228PZN2_9BURK, A0A228HZP1_9BURK, B4E6R3_BURCJ, A0A3N8HPB5_9BURK, A0A365QNN2_9BURK, A0A095DVF1_BURCE, A0A0H2XTR8_BURCA, B1JUN7_BURCC, Q39K56_BURL3, A0A1B4HQA1_9BURK, A0A087NNS1_BURPY, A0A4Q2AR48_9BURK, A0A071MFD7_9BURK
KEGG ID bmec:WJ16_01955, bpsl:WS57_19815, bur:Bcep18194_A3559, bcn:Bcen_2639, bcj:BCAL0341, bcm:Bcenmc03_0445, bpyr:ABD05_07970
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 6.7e-61 12..162

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-171 MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQELAKGTGGDKDGE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9966 - -



  Protein sequence: 172 a.a.    

>T6CP001225 NC_008060:c2906507-2905992 [Burkholderia cenocepacia AU 1054] [TssB]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNFDDVMKAIEPR
AAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQEL
AKGTGGDKDGE*

  Nucleotide sequence: 516 bp    

>T6CP001225 NC_008060:c2906507-2905992 [Burkholderia cenocepacia AU 1054] [TssB]
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACGAGGTCGAGAA
GGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTCGGGGTCGTTGGCGATCTGGCGGGCCAGTCCGAAATCGAGC
AGCCGAAGCTGCGCGATCGTAAATTCGTCAACATCGACCGCGATAATTTCGACGACGTGATGAAGGCGATCGAGCCGCGT
GCCGCGTTCCAGGTGGAAAATCGCCTGAGCCCGGAAGGCGGCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGA
TTTCAGCCCGGACGAAGTCGTCGAACAGGTCGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGC
GCAACAAGCTCGCCGGCAACGACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTC
GCGAAGGGCACCGGCGGCGACAAAGACGGCGAATGA