Detailed information of component protein


Summary

Component ID T6CP001224
Component protein type TssC
T6SS ID (Type) T6SS00126 experimental (Type i4b)
Strain Burkholderia cenocepacia AU 1054
Replicon chromosome I
Sequence Protein sequence (497 a.a.); Nucleotide sequence (1491 bp)
Reference
[1] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[2] Perault AI, Chandler CE, Rasko DA, et al. Host Adaptation Predisposes Pseudomonas aeruginosa to Type VI Secretion System-Mediated Predation by the Burkholderia cepacia Complex. Cell Host Microbe. 2020 Oct 7;28(4):534-547.e3. doi: 10.1016/j.chom.2020.06.019. Epub 2020 Aug 4. PMID: 32755549
[3] Loeven NA, Perault AI, Cotter PA, et al. The Burkholderia cenocepacia Type VI Secretion System Effector TecA Is a Virulence Factor in Mouse Models of Lung Infection. mBio. 2021 Oct 26;12(5):e0209821. doi: 10.1128/mBio.02098-21. Epub 2021 Sep 28. PMID: 34579569
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BCEN_RS13145
Coordinate (Strand) 2904486..2905976 (-)
NCBI ID WP_006477094.1
RefSeq NC_008060
Uniprot ID U2FFM3_9BURK, A0A4S5CSS6_9BURK, A0A6J5EZA0_9BURK, A0A084D9C8_9BURK, A0A1X1P7P0_9BURK, A0A228HZL2_9BURK, A0A228K5B3_9BURK, A0A4R4BXL0_9BURK, A0A2U9SFG4_9BURK, A0A365QNN8_9BURK, A0A103ZDU3_BURCE, A0A0H2XSR5_BURCA, A2VTE1_9BURK, B1JUN8_BURCC, A0A6P3A043_BURL3, A0A0G3YVX6_9BURK, A0A087NNS2_BURPY, A0A1Y1BI97_9BURK, A0A0M1IL55_9BURK, A0A806UQD0_BURCE
KEGG ID bcep:APZ15_05950, bcm:Bcenmc03_0446, bcn:Bcen_2638, bcon:NL30_20120
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 5.9e-136 68..370
VipB_2 PF18945.2 1.5e-46 380..490

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-496 MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDARVAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGKPRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCNAAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNVETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADLPKPANS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9250 - -



  Protein sequence: 497 a.a.    

>T6CP001224 NC_008060:c2905976-2904486 [Burkholderia cenocepacia AU 1054] [TssC]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDARVAELDRLIST
QLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGA
LIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGKPRDLGKVFDTVEYAKWKSFRDAEDSRYVGL
TLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCNAAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFK
TDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVA
HYLKAMMRDKIGSFASAQNVETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS*

  Nucleotide sequence: 1491 bp    

>T6CP001224 NC_008060:c2905976-2904486 [Burkholderia cenocepacia AU 1054] [TssC]
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGCTGCTCGACGACATCGTCGA
GAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGAACTCGTGCATCAGGTGCTCG
ACGGCACGGTGATCGTGTCGGACAACCTGTCGGCCACGATCGACGCGCGCGTCGCGGAGCTCGACCGCCTGATTTCCACG
CAGCTTTCCGCCGTGATGCACGCGCCGGAATTCCAGCGCCTCGAAAGCACGTGGCGCGGGATGGATTATCTGGTCAAGGA
AAGCAACACGGGCCAGACGATCAAGATCAAGGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGGGCGCGA
GCGAGTTCGACCAGAGCGCGCTGTTCAAGAAGGTCTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGTGCG
CTGATCGGCGATTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCATGTCGCGGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAGCCGCGCGACC
TCGGCAAGGTGTTCGACACCGTCGAATACGCGAAGTGGAAGTCGTTCCGAGACGCCGAGGATTCGCGCTACGTCGGCCTG
ACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCAGACCGCGGAGAACTTCAACTTCGTCGAGGA
CGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAACGCGGCATGGGCCTTCGCGGCCCGCCTGACGGCCGCGTTCG
ACGACTTCGGCTGGTGCGCGGCGATCCGCGGCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAG
ACCGACGACGGTGAAGTCGCGCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGATCT
CGGCTTCATCCCGCTCGTCCATTGCAAGAACTCAGATTACGCCGCGTTCTTCGCTGCGCAGTCGGTGCAGAAGCCCAAGA
AATACAGCACCGACAGCGCGAACGCGAATGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATCGCGCGTCGCG
CACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTGGAGACTTTCCTCAACCGGTG
GATTTCGCAGTACGTCCTGCTCGACGACAACGCCTCGCAGGAACAGAAAGCGCAATTTCCGCTGCGCGAGGCATCCATAC
AAGTGTCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTCGGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTC
TCGATTTCTCTGCGACTTGTCGCTGATCTGCCCAAACCGGCAAATTCATAA