Detailed information of component protein


Summary

Component ID T6CP001223
Component protein type TssD
T6SS ID (Type) T6SS00126 experimental (Type i4b)
Strain Burkholderia cenocepacia AU 1054
Replicon chromosome I
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Reference
[1] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[2] Perault AI, Chandler CE, Rasko DA, et al. Host Adaptation Predisposes Pseudomonas aeruginosa to Type VI Secretion System-Mediated Predation by the Burkholderia cepacia Complex. Cell Host Microbe. 2020 Oct 7;28(4):534-547.e3. doi: 10.1016/j.chom.2020.06.019. Epub 2020 Aug 4. PMID: 32755549
[3] Loeven NA, Perault AI, Cotter PA, et al. The Burkholderia cenocepacia Type VI Secretion System Effector TecA Is a Virulence Factor in Mouse Models of Lung Infection. mBio. 2021 Oct 26;12(5):e0209821. doi: 10.1128/mBio.02098-21. Epub 2021 Sep 28. PMID: 34579569
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BCEN_RS13140
Coordinate (Strand) 2903912..2904415 (-)
NCBI ID WP_006477093.1
RefSeq NC_008060
Uniprot ID A0A0B1YQS5_9BURK, A0A0U4DCL3_BURCE, A0A4S5CPF0_9BURK, A0A6J5EX57_9BURK, A0A084D9C9_9BURK, A0A2S9KZ71_9BURK, A0A1K1S9E0_9BURK, A0A4V8GCX1_9BURK, A0A117VGM3_9BURK, A0A1B4F605_9BURK, A0A103LBA0_9BURK, A0A2A4CEA2_9BURK, A0A6P2GAQ5_9BURK, A0A1X1P7H9_9BURK, A0A2A9LW14_9BURK, A0A228PYE3_9BURK, A0A228HBG8_9BURK, A0A228I0N3_9BURK, A0A228J4P0_9BURK, A0A228K684_9BURK, A0A228RK00_9BURK, A0A228QKE8_9BURK, A0A4R4BX44_9BURK, A0A495YLN9_9BURK, B4E6R5_BURCJ, A0A364GSY9_9BURK, A0A3N8GU54_9BURK, A0A3P0S1M1_9BURK, A0A3N8D151_9BURK, A0A3P0NX81_9BURK, A0A3P0MQB7_9BURK, A0A3N8C350_9BURK, A0A3N7ZH20_9BURK, A0A3N7ZEL0_9BURK, A0A2U9SGD4_9BURK, A0A365QNQ2_9BURK, A0A7C9FHE2_9BURK, A0A081V0J2_BURCE, A0A0H2XRS0_BURCA, Q0BIT1_BURCM, A2VTE0_9BURK, B1FDD0_9BURK, B1T015_9BURK, B1YS99_BURA4, B1JUN9_BURCC, Q39K54_BURL3, A0A0G3YXS0_9BURK, A0A1B4HQA6_9BURK, A0A6P2PVE7_9BURK, A0A1B4BP34_9BURK, A0A087NNS3_BURPY, A0A1D7ZEA5_9BURK, A0A0M1IMJ7_9BURK, A0A806USC6_BURCE
KEGG ID bcon:NL30_20125, bcep:APZ15_05955, bcn:Bcen_2637, bcm:Bcenmc03_0447, bdf:WI26_01920, bstl:BBJ41_12130, bur:Bcep18194_A3561, bam:Bamb_0383, bcj:BCAL0343, bpyr:ABD05_07980, bmec:WJ16_01965, bac:BamMC406_0404
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.1e-37 10..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9447 - -



  Protein sequence: 168 a.a.    

>T6CP001223 NC_008060:c2904415-2903912 [Burkholderia cenocepacia AU 1054] [TssD]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGT
TFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTK
NDKTYAV*

  Nucleotide sequence: 504 bp    

>T6CP001223 NC_008060:c2904415-2903912 [Burkholderia cenocepacia AU 1054] [TssD]
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAGTCCGCGGATAAAGACCACCAAGGCTGGATCGA
ACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCATCGACCGCTGGCGGTCACACGATGACGCGTT
GCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCGCTGCTGTATCAGCATGCTTCGGGCGGTACC
ACGTTCGACGAAGTGACGGTCCATTTCTCGCGCGCGGACGGTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAA
GTACGTGATCATCTCGAGCATCGCGCCGAGCGTTCGCGAGGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAG
CCGTGCAGTGGAAGCAAACCCAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGTCTGACGAAG
AACGACAAGACCTACGCGGTCTAA