Detailed information of component protein
Summary
| Component ID |
T6CP001096 |
| Component protein type |
TssL |
| T6SS ID (Type) |
T6SS00115  (Type i4b) |
| Strain |
Burkholderia thailandensis E264 |
| Replicon |
chromosome I |
| Sequence |
Protein sequence (262 a.a.); Nucleotide sequence (786 bp) |
| Reference |
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806[2] Schwarz S, West TE, Boyer F, et al. Burkholderia type VI secretion systems have distinct roles in eukaryotic and bacterial cell interactions. PLoS Pathog. 2010 Aug 26;6(8):e1001068. doi: 10.1371/journal.ppat.1001068. PMID: 20865170[3] Russell AB, LeRoux M, Hathazi K, et al. Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 2013 Apr 25;496(7446):508-12. doi: 10.1038/nature12074. Epub 2013 Apr 3. PMID: 23552891[4] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068[5] Lennings J, Makhlouf M, Olejnik P, et al. Environmental and cellular factors affecting the localization of T6SS proteins in Burkholderia thailandensis. Int J Med Microbiol. 2019 Sep;309(6):151335. doi: 10.1016/j.ijmm.2019.151335. Epub 2019 Jul 18. PMID: 31378704 |
Experimental investigation has been performed on this T6SS
External database links
Pfam domain hit(s)
| Domain |
Pfam ID |
E-value |
Aligned region |
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction |
Region |
Sequence |
| Outside |
1-209 |
MSYAPSLFGGNTPPPAPHTVSSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFSTRIQEFLGEFERGAKKLNIAADDVYAAKFAFCAAIDESVLSSQFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVP |
| Transmembrane helix |
210-232 |
LWAIGAVFALVGLLAFVGLNTYL |
| Inside |
233-261 |
KDSTVRALAPYSQVIKVGPESANLTISLP |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction |
Probability |
Cleavage site |
Signal peptide sequence |
| Other |
0.9730 |
- |
- |
Protein sequence: 262 a.a.
Nucleotide sequence: 786 bp