Detailed information of component protein


Summary

Component ID T6CP001094
Component protein type TssJ
T6SS ID (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome I
Sequence Protein sequence (205 a.a.); Nucleotide sequence (615 bp)
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Schwarz S, West TE, Boyer F, et al. Burkholderia type VI secretion systems have distinct roles in eukaryotic and bacterial cell interactions. PLoS Pathog. 2010 Aug 26;6(8):e1001068. doi: 10.1371/journal.ppat.1001068. PMID: 20865170
[3] Russell AB, LeRoux M, Hathazi K, et al. Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 2013 Apr 25;496(7446):508-12. doi: 10.1038/nature12074. Epub 2013 Apr 3. PMID: 23552891
[4] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BTH_RS27320
Coordinate (Strand) 3413466..3414080 (+)
NCBI ID WP_025404121.1
RefSeq NC_007651
Uniprot ID A0A1B4JS76_BURTH
KEGG ID btha:DR62_836
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 4.7e-30 55..173

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MNPLVT
Transmembrane helix 7-29 RYALPLAACILLGGCAAAVPLLG
Outside 30-204 SAGSAALQMVGIGKPDVPDSQKPPRNLGLTLYAAQNLNAANDNRPLALVVRLYALKDPTSFQQAPFDSFTDPAKEKTALGADLLSVREITLIPGQRYNATEKVSREAQAFGVVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.8558 pos: 20-21. LGG-CA. MNPLVTRYALPLAACILLGG



  Protein sequence: 205 a.a.    

>T6CP001094 NC_007651:3413466-3414080 [Burkholderia thailandensis E264] [TssJ]
MNPLVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGIGKPDVPDSQKPPRNLGLTLYAAQNLNAANDNRPLALVVR
LYALKDPTSFQQAPFDSFTDPAKEKTALGADLLSVREITLIPGQRYNATEKVSREAQAFGVVALFRDPALQRWKLTFDPA
KSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG*

  Nucleotide sequence: 615 bp    

>T6CP001094 NC_007651:3413466-3414080 [Burkholderia thailandensis E264] [TssJ]
ATGAATCCGCTTGTGACTCGTTACGCGTTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCGCCGTGCCGCT
CCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCATCGGCAAGCCCGACGTGCCCGATTCGCAAAAGCCGCCGC
GCAATCTCGGCCTCACGCTCTACGCCGCGCAGAACCTCAACGCCGCGAACGACAACCGCCCGCTCGCGCTTGTCGTGCGC
CTCTACGCGCTGAAAGACCCGACGTCGTTCCAGCAGGCGCCGTTCGACAGCTTCACCGATCCAGCGAAAGAGAAGACCGC
GCTCGGCGCCGATCTGCTGAGCGTGCGCGAAATCACGCTGATTCCCGGACAGCGCTACAACGCGACAGAGAAGGTATCGC
GCGAAGCGCAGGCATTCGGCGTCGTCGCGCTCTTTCGCGACCCGGCGCTGCAGCGCTGGAAACTGACTTTCGATCCGGCG
AAGTCCGAGAAATCCGGCATAATTATCGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATTCCTTCGCA
GCAGGGCATGCCGACGCAGCGGCTCGATTTGCTTTCGTCGGTGAACTGCGGGTGA