Detailed information of component protein


Summary

Component ID T6CP001087
Component protein type TssH
T6SS ID (Type) T6SS00115 experimental (Type i4b)
Strain Burkholderia thailandensis E264
Replicon chromosome I
Sequence Protein sequence (888 a.a.); Nucleotide sequence (2664 bp)
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Schwarz S, West TE, Boyer F, et al. Burkholderia type VI secretion systems have distinct roles in eukaryotic and bacterial cell interactions. PLoS Pathog. 2010 Aug 26;6(8):e1001068. doi: 10.1371/journal.ppat.1001068. PMID: 20865170
[3] Russell AB, LeRoux M, Hathazi K, et al. Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 2013 Apr 25;496(7446):508-12. doi: 10.1038/nature12074. Epub 2013 Apr 3. PMID: 23552891
[4] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BTH_RS27280
Coordinate (Strand) 3403545..3406208 (-)
NCBI ID WP_009910486.1
RefSeq NC_007651
Uniprot ID Q2SUD4_BURTA
KEGG ID bte:BTH_I2958
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AAA_2 PF07724.16 1.7e-42 617..786
AAA_lid_9 PF17871.3 1.7e-28 372..470
ClpB_D2-small PF10431.11 4.3e-11 792..867
Clp_N PF02861.22 8.7e-11 29..74
AAA PF00004.31 9.6e-10 230..342

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-887 MSTPLKTLIAKLNPVCRKAAERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADLERELEGLKAGNTRTPVFSVHLTELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSPQFARVRIDDLKHKFDEITAGSIETEPRQAEADIAVPDGAAADSPRGPSKTPALDTYTTNLTQRASEGKIDPVIGRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALKIAADDVPPPLSGVALHVLDMGLLQAGASVKGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALARRFQVVKIDEPSEPLAAAMLRGMAGLMEQHFNVRILDNAITEAVRLSHRYISGRQLPDKAISVLDTACAKVALAHSATPAAIDDAKKRIERIDAEIAALEREAASGAAHDERLAELRAEREADLKALAEDEARYEEERALVTEIGALRAELDAAREPSADGRPADIDATRAKLAERVDALRALQGNQPMVPLQVDGHVIAEIVASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALDAIAQRVRTATANLEDPNKPRGVFMFVGPSGVGKTETALALADVLYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSPAVMQACLNKTQEELPDAETLAETLRPQLYKTFKPAFLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDSGARNVDHILNGTLLPEIAEHVLSRIADGEAIARIAARAAETGEFEYTVE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9927 - -



  Protein sequence: 888 a.a.    

>T6CP001087 NC_007651:c3406208-3403545 [Burkholderia thailandensis E264] [TssH]
MSTPLKTLIAKLNPVCRKAAERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADLERELEGLKAG
NTRTPVFSVHLTELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSPQFARVRIDDLKHKFDEITAGSIETE
PRQAEADIAVPDGAAADSPRGPSKTPALDTYTTNLTQRASEGKIDPVIGRDAEIRQAIDILMRRRQNNPIMTGEAGVGKT
AVVEGLALKIAADDVPPPLSGVALHVLDMGLLQAGASVKGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQN
DAANLLKPALARGELRTIAATTWSEYKKYFEKDAALARRFQVVKIDEPSEPLAAAMLRGMAGLMEQHFNVRILDNAITEA
VRLSHRYISGRQLPDKAISVLDTACAKVALAHSATPAAIDDAKKRIERIDAEIAALEREAASGAAHDERLAELRAEREAD
LKALAEDEARYEEERALVTEIGALRAELDAAREPSADGRPADIDATRAKLAERVDALRALQGNQPMVPLQVDGHVIAEIV
ASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALDAIAQRVRTATANLEDPNKPRGVFMFVGPSGVGKTETALALAD
VLYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGAMD
DAEGREIDFRNTLIILTSNVGSPAVMQACLNKTQEELPDAETLAETLRPQLYKTFKPAFLGRMKVIPYYPISDDVLAEII
ELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDSGARNVDHILNGTLLPEIAEHVLSRIADGEAIARIAARAAETG
EFEYTVE*

  Nucleotide sequence: 2664 bp    

>T6CP001087 NC_007651:c3406208-3403545 [Burkholderia thailandensis E264] [TssH]
ATGAGCACGCCCCTGAAGACCCTGATCGCGAAACTGAATCCGGTGTGCCGGAAGGCCGCCGAACGCGCCGCCAGCCATTG
CTTCGCACGCGGTCACTACGAAGTGGATCTCGAGCACTTGTTTCTCGCGCTGCTCGACGAATCGACCGGAGACGTGCCGC
TCGTGTTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCGCGGACCTCGAGCGCGAGCTTGAAGGCCTGAAGGCGGGC
AACACGCGTACGCCGGTGTTCTCGGTGCATCTGACCGAGCTGTTCGAGCAGGCGTGGCTCATCGCGTCGCTCGATTCGCA
GATCGGACGGATTCGCTCGGGCCACCTGCTGCTCGCGCTGCTGACGGGGCCGGATCTCGCGCAGTTCGCGCAGCGGATGT
CGCCGCAGTTCGCGCGCGTGAGAATCGATGACCTGAAGCACAAGTTCGACGAGATCACGGCGGGCTCGATCGAGACCGAG
CCGCGACAAGCGGAAGCCGACATCGCGGTGCCGGACGGCGCGGCGGCGGACTCGCCGCGCGGCCCGTCGAAGACGCCGGC
GCTCGACACGTATACGACGAACCTCACGCAGCGCGCGAGCGAAGGCAAGATCGATCCGGTGATCGGCCGCGACGCGGAGA
TTCGCCAGGCGATCGACATCCTGATGCGCCGCCGGCAGAACAATCCGATCATGACGGGTGAGGCGGGCGTCGGCAAGACG
GCCGTCGTCGAAGGGCTCGCGCTGAAGATCGCGGCCGACGACGTGCCGCCGCCGCTTTCCGGCGTCGCGTTGCACGTGCT
CGACATGGGTTTGCTGCAGGCGGGCGCAAGCGTGAAGGGCGAGTTCGAGAATCGCCTGAAGAGCGTGATCGACGAAGTGA
AGAAGAGCGCGCACCCGATCATCCTCTTCATCGACGAAGCGCACACGATCATCGGCGCGGGCGGGCAGGCCGGCCAGAAC
GACGCGGCTAACCTGCTGAAGCCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCGGCGACCACGTGGAGCGAATACAA
GAAGTACTTCGAGAAGGATGCGGCGCTCGCGCGGCGCTTCCAGGTCGTGAAGATCGACGAGCCGAGCGAGCCGCTCGCCG
CCGCGATGCTGCGCGGGATGGCGGGGCTGATGGAGCAGCACTTCAACGTACGCATTCTCGACAATGCGATCACCGAGGCG
GTGCGGCTGTCGCATCGCTACATCAGCGGCCGCCAACTGCCCGACAAGGCGATCAGCGTGCTCGACACCGCGTGCGCGAA
GGTCGCGCTCGCGCACAGCGCGACGCCCGCCGCAATCGACGACGCGAAGAAGCGCATCGAGCGGATCGACGCGGAGATCG
CGGCGCTCGAGCGTGAAGCCGCGAGCGGCGCCGCGCATGACGAGCGCCTTGCCGAGCTGCGCGCCGAGCGCGAGGCCGAT
CTGAAGGCGCTGGCCGAAGACGAGGCGCGCTACGAAGAGGAGCGCGCGCTCGTGACCGAAATCGGCGCGCTGCGCGCCGA
GCTCGACGCCGCGCGCGAGCCGTCGGCCGACGGTCGGCCGGCCGACATCGACGCGACGCGCGCGAAGCTCGCCGAGCGCG
TCGATGCGTTGCGTGCGCTGCAGGGCAACCAGCCGATGGTGCCGCTGCAGGTCGATGGCCACGTCATTGCGGAAATCGTC
GCGTCGTGGACGGGCATTCCGCTCGGACGAATGGTGAAGGACGAGATCGAGACCGTGCTCAATCTGCGCGATCTGCTCGG
TGCGCGCGTGATCGGCCAGGACCACGCGCTCGACGCGATCGCGCAGCGCGTGCGCACCGCGACCGCGAACCTCGAGGACC
CGAACAAGCCGCGTGGCGTGTTCATGTTCGTCGGGCCGTCGGGCGTCGGCAAGACCGAGACCGCGCTTGCGCTTGCAGAC
GTGCTGTACGGCGGCGAACGCAAGATGATCACGATCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAA
GGGCTCGCCGCCCGGTTACGTCGGCTACGGCGAGGGCGGCGTGCTGACGGAGGCGGTGCGCCGCAATCCGTACTCGGTCG
TGCTGCTCGACGAAGTCGAGAAGGCGCATCCGGATGTGCTCGAAATGTTCTTCCAGGTGTTTGACAAGGGCGCGATGGAC
GACGCCGAAGGCCGCGAGATCGACTTCCGCAATACGCTGATCATCCTGACGTCGAACGTCGGCTCGCCGGCGGTGATGCA
GGCGTGCCTGAACAAGACGCAGGAAGAGCTGCCCGATGCCGAGACGCTTGCCGAGACGCTGCGCCCGCAACTCTACAAGA
CCTTCAAGCCCGCGTTCCTCGGCCGCATGAAGGTGATTCCGTACTATCCGATCTCCGACGACGTGCTCGCCGAGATCATC
GAGCTGAAACTCGAACGGATTCGCCGCCGGATCGAAGCGAACCACAAGGCCGCGTTCGAATGGGACGAGTCGCTTGTCGA
CGCCGTGCTCGCGCGCTGCACCGAAGTCGATTCGGGCGCGCGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCCG
AGATCGCCGAGCACGTGCTGTCGCGGATCGCCGACGGCGAGGCGATCGCGCGGATCGCCGCGCGCGCGGCCGAGACGGGC
GAGTTCGAGTACACGGTCGAGTAA