Detailed information of component protein


Summary

Component ID T6CP001062
Component protein type TssM
T6SS ID (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome II
Sequence Protein sequence (1297 a.a.); Nucleotide sequence (3891 bp)
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Schwarz S, West TE, Boyer F, et al. Burkholderia type VI secretion systems have distinct roles in eukaryotic and bacterial cell interactions. PLoS Pathog. 2010 Aug 26;6(8):e1001068. doi: 10.1371/journal.ppat.1001068. PMID: 20865170
[3] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068
[4] Schwarz S, Singh P, Robertson JD, et al. VgrG-5 is a Burkholderia type VI secretion system-exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 2014 Apr;82(4):1445-52. doi: 10.1128/IAI.01368-13. Epub 2014 Jan 22. PMID: 24452686
[5] Schwarz S, Singh P, Robertson JD, et al. VgrG-5 is a Burkholderia type VI secretion system-exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 2014 Apr;82(4):1445-52. doi: 10.1128/IAI.01368-13. Epub 2014 Jan 22. PMID: 24452686
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BTH_RS04440
Coordinate (Strand) 997685..1001575 (-)
NCBI ID WP_009896173.1
RefSeq NC_007650
Uniprot ID Q2T6Z7_BURTA
KEGG ID bte:BTH_II0855
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 4.5e-53 178..420

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MKTLCS
Transmembrane helix 7-26 MLARIAALIALAALSWATAL
Outside 27-29 YFD
Transmembrane helix 30-52 WPWWGAPAVFCAALAVWPLFGVA
Inside 53-415 RRALRAVRARAQLARLDGAKRLPADRDAPLRRVVARWRAALDALERAAPAPGLRGRPRDALPWYLVIGRAGAGKTTALARARIASPLRRARHDASLAPTEDCDWWCFDDAVVLDLAGRFAEPDATDDDRRAWGALLEQLGRARARRGINGVVVAIDAPRLVTADRDALTIDGCAVRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVAHALEHVDARLAALRIALAARGEPPSPRALMLPHELARLRPALEALARAAFGPNVYQETPYLRGLLFSSGRQAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDASRPVERPSRSRLTPRR
Transmembrane helix 416-438 LALAAWLFACVAAGLLMSASFVG
Outside 439-1296 DIRTVELIRRDYPAHPRFTGELAHDAATLARIARVIADVERCDERRLVRRLARPIADATPVGRLEAQLKRRYIAHYRRAIEPAADRLLFGEPDGASGARAADDGDIAVRIRNLVRYVNLMQARRRGADRETLARMPAPALARARDGGGASRADGARSAGGMSDTGDSGDTSDRTGRLSALIGALAVDRIAWSAPDDATLAARIAAAQAQLERLAYRDPDGAWLLALPDASAPRDVTLADFWPAAAPRTPPPEPRDARVPAALTAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLATQAQWRAVIDTIADRRDPFAALLARVDREFESVRDDALPPWLRFVRTASRMLAPARVPAASGGLGAALGSISRSGGRALREALGGAPEQGRRTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVEASAMRAADDALRDVKRLAGERDVGGDVVWSLVGGPLHAVIAYVERQASCALQEDWERDVLWPLRRAATREDADDRLYGPQGAFWAFVDGPAKPFVRVGAARASAVDTLGYRLPFTDAFLPLVDDAAARRVAQARRADEQRARQQAAAELDERIASLGKQIDAIRAQTVRIEIVAQPTDVNPEARARPFETVLTLQCAPQARTLANYNLRVSERIDWQPDQCGDATLRIALGGVTLTRRYAGPLGIARFVQDFRYGVRRFTPGDFPDAKAQLERLGVRHVDVRYDFSGHDALLAHVERIDALERARRDDIARQRRIASRQDDGASDSGAAAIARAGGFAANPANPANTARAPSASSRSSPSPAPGASAPSGTPDAGLPRRIGACWGDPARDGGMRP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8698 - -



  Protein sequence: 1297 a.a.    

>T6CP001062 NC_007650:c1001575-997685 [Burkholderia thailandensis E264] [TssM]
MKTLCSMLARIAALIALAALSWATALYFDWPWWGAPAVFCAALAVWPLFGVARRALRAVRARAQLARLDGAKRLPADRDA
PLRRVVARWRAALDALERAAPAPGLRGRPRDALPWYLVIGRAGAGKTTALARARIASPLRRARHDASLAPTEDCDWWCFD
DAVVLDLAGRFAEPDATDDDRRAWGALLEQLGRARARRGINGVVVAIDAPRLVTADRDALTIDGCAVRERLEQLIRLFDR
RFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVAHALEHVDARLAALRIALAARGEPPSPRALMLPHE
LARLRPALEALARAAFGPNVYQETPYLRGLLFSSGRQAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAS
RPVERPSRSRLTPRRLALAAWLFACVAAGLLMSASFVGDIRTVELIRRDYPAHPRFTGELAHDAATLARIARVIADVERC
DERRLVRRLARPIADATPVGRLEAQLKRRYIAHYRRAIEPAADRLLFGEPDGASGARAADDGDIAVRIRNLVRYVNLMQA
RRRGADRETLARMPAPALARARDGGGASRADGARSAGGMSDTGDSGDTSDRTGRLSALIGALAVDRIAWSAPDDATLAAR
IAAAQAQLERLAYRDPDGAWLLALPDASAPRDVTLADFWPAAAPRTPPPEPRDARVPAALTAAHRPAIDAFLDEMAQAVA
NRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLATQAQWRAVIDTIADRRDPFAALLARVDREFESVRDDALPPW
LRFVRTASRMLAPARVPAASGGLGAALGSISRSGGRALREALGGAPEQGRRTLERDAALRDALVDYERRVAALAADALAG
PGAAYRLAADFHGFGVDPSVEASAMRAADDALRDVKRLAGERDVGGDVVWSLVGGPLHAVIAYVERQASCALQEDWERDV
LWPLRRAATREDADDRLYGPQGAFWAFVDGPAKPFVRVGAARASAVDTLGYRLPFTDAFLPLVDDAAARRVAQARRADEQ
RARQQAAAELDERIASLGKQIDAIRAQTVRIEIVAQPTDVNPEARARPFETVLTLQCAPQARTLANYNLRVSERIDWQPD
QCGDATLRIALGGVTLTRRYAGPLGIARFVQDFRYGVRRFTPGDFPDAKAQLERLGVRHVDVRYDFSGHDALLAHVERID
ALERARRDDIARQRRIASRQDDGASDSGAAAIARAGGFAANPANPANTARAPSASSRSSPSPAPGASAPSGTPDAGLPRR
IGACWGDPARDGGMRP*

  Nucleotide sequence: 3891 bp    

>T6CP001062 NC_007650:c1001575-997685 [Burkholderia thailandensis E264] [TssM]
ATGAAGACGCTTTGCTCGATGCTCGCGCGGATCGCCGCGCTGATCGCGCTCGCCGCGCTCAGTTGGGCGACCGCGCTCTA
TTTCGACTGGCCGTGGTGGGGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGTTTGGCCGCTGTTTGGCGTCGCGCGAC
GCGCGCTGCGCGCCGTTCGCGCGCGCGCGCAGCTCGCGAGGCTCGACGGAGCCAAGCGCCTGCCCGCCGATCGCGACGCG
CCGCTGCGGCGCGTCGTCGCGCGCTGGCGCGCGGCGCTCGATGCGCTCGAACGCGCCGCGCCCGCGCCGGGCCTGCGCGG
CCGGCCGCGCGACGCGCTGCCCTGGTATCTCGTGATCGGCCGCGCGGGCGCGGGCAAGACGACGGCGCTCGCGCGCGCGC
GCATCGCGTCGCCGCTGCGGCGCGCGCGCCACGACGCGAGCCTCGCCCCTACCGAGGATTGCGACTGGTGGTGCTTCGAC
GATGCGGTCGTGCTCGACCTCGCGGGCCGCTTCGCCGAGCCCGACGCGACCGACGACGACCGCCGCGCATGGGGCGCGCT
GCTCGAACAGCTCGGCCGCGCGCGCGCGCGCCGGGGCATCAACGGCGTCGTCGTCGCGATCGATGCGCCGCGCCTCGTCA
CCGCAGATCGCGACGCGTTGACGATCGACGGCTGCGCGGTTCGCGAGCGGCTGGAGCAACTGATTCGCCTGTTCGACCGG
CGCTTTCCGGTCTATGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCAGCTCGCGCCGGA
GCAACGCGAGCGCGCATTCGGCTATCTCGGCGATCACGATGCGGATGCGTTCGTCGCGCACGCGCTCGAGCATGTCGACG
CGCGGCTCGCCGCGCTGCGCATCGCGCTGGCAGCGCGCGGCGAGCCGCCGTCGCCGCGCGCGCTGATGCTGCCGCACGAA
CTCGCGCGCTTGCGGCCCGCGCTCGAAGCGCTCGCGCGCGCGGCGTTCGGCCCGAACGTCTATCAGGAAACGCCGTATCT
GCGCGGGCTGCTGTTCTCGAGCGGCCGGCAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGC
CGGCGCGCACGCCCGGCGACGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTCG
CGGCCCGTCGAGCGGCCGAGCCGCTCGCGGCTGACGCCGCGGCGTCTCGCACTGGCCGCGTGGCTCTTCGCGTGCGTCGC
GGCCGGGCTGCTGATGAGCGCGTCGTTCGTCGGCGACATCCGAACGGTCGAGCTGATCCGCCGCGACTATCCCGCGCATC
CGCGCTTCACGGGCGAGCTCGCGCACGATGCGGCGACGCTCGCGCGGATCGCTCGCGTGATCGCCGACGTCGAGCGGTGC
GACGAGCGGCGGCTCGTGCGGCGGCTCGCGCGCCCGATCGCCGACGCGACGCCTGTCGGCCGGCTCGAAGCGCAGCTCAA
GCGCCGCTACATCGCGCATTATCGACGCGCGATCGAGCCGGCCGCCGACCGGCTGCTCTTCGGCGAGCCGGACGGCGCGA
GCGGCGCGCGCGCGGCGGACGACGGCGACATCGCCGTGCGCATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCG
CGCCGGCGCGGCGCGGATCGCGAGACGCTCGCGCGCATGCCCGCGCCGGCGCTCGCGCGCGCGCGGGATGGCGGCGGCGC
AAGCCGCGCGGACGGCGCGCGGAGCGCCGGCGGCATGAGCGACACCGGCGACTCGGGCGACACGAGCGATCGCACCGGCA
GGCTGTCCGCGCTTATCGGCGCGCTCGCCGTAGACCGGATCGCGTGGAGCGCGCCCGACGACGCCACGCTCGCCGCGCGG
ATCGCGGCCGCGCAGGCGCAGCTCGAACGGCTCGCGTACCGCGACCCGGACGGCGCATGGCTGCTCGCGCTGCCCGACGC
ATCGGCGCCGCGCGACGTGACGCTCGCCGACTTCTGGCCGGCCGCCGCGCCGCGCACGCCGCCCCCCGAGCCGCGCGACG
CGCGCGTTCCCGCCGCGCTGACGGCCGCGCATCGTCCGGCGATCGACGCGTTTCTCGACGAGATGGCGCAAGCGGTCGCG
AACCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTATCGCGCGCGGCGCATCGACGCGTGGCGCGACTT
CGTCGCGCGTTTTCCGCAGGGCGAGCAAGGGCTCGCGACGCAAGCGCAATGGCGCGCGGTGATCGACACGATTGCCGATC
GCCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAGTTCGAATCAGTTCGCGACGACGCGCTGCCGCCGTGG
CTGCGGTTCGTCCGGACGGCGTCGCGCATGCTCGCGCCCGCGCGCGTGCCCGCGGCGAGCGGCGGCCTCGGCGCGGCGCT
CGGCTCGATCTCGCGCAGCGGCGGCCGCGCGCTGCGCGAGGCGCTCGGCGGCGCGCCCGAGCAAGGCCGGCGCACGCTCG
AGCGCGACGCCGCGCTGCGCGACGCGCTCGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGCGCTCGCGGGT
CCCGGCGCCGCGTACCGGCTCGCGGCCGACTTCCACGGCTTCGGCGTCGATCCGTCCGTCGAGGCATCCGCGATGCGCGC
GGCCGACGATGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGAGCGCGATGTCGGCGGCGACGTCGTCTGGAGCCTCGTCG
GCGGTCCGCTGCACGCGGTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGCAAGAGGACTGGGAACGCGACGTG
CTGTGGCCGCTCAGGCGCGCGGCGACGCGCGAGGACGCCGACGACCGGCTGTACGGCCCGCAAGGCGCGTTCTGGGCGTT
CGTCGACGGCCCGGCGAAACCGTTCGTGCGCGTCGGCGCGGCGCGCGCGTCGGCGGTCGACACGCTCGGCTACCGGCTGC
CGTTCACCGACGCGTTCCTGCCGCTCGTCGACGACGCGGCCGCCCGGCGCGTCGCGCAGGCGCGGCGCGCCGACGAGCAG
CGCGCGCGACAGCAGGCGGCGGCCGAGCTCGACGAGCGGATCGCTTCGCTCGGCAAGCAGATCGACGCGATCCGCGCGCA
GACGGTGCGCATCGAAATCGTCGCGCAGCCGACCGACGTGAACCCGGAAGCGCGAGCGCGGCCGTTCGAGACCGTGCTGA
CACTGCAATGCGCGCCGCAGGCGCGCACGCTCGCGAACTACAACCTGCGCGTGTCCGAGCGGATCGACTGGCAACCCGAT
CAATGCGGCGACGCGACGCTGCGCATCGCGCTCGGCGGCGTCACGCTCACGCGCCGCTACGCGGGACCGCTCGGCATCGC
GCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCGGCGATTTCCCGGATGCGAAAGCGCAACTCGAAC
GTCTCGGCGTGCGCCACGTCGACGTGCGCTACGACTTCTCGGGGCACGACGCGCTGCTCGCGCACGTCGAGCGGATCGAC
GCGCTCGAACGCGCCCGCCGCGACGACATCGCGCGGCAGCGGCGCATCGCGAGCCGGCAGGACGACGGCGCAAGCGACAG
CGGCGCGGCCGCGATCGCGCGTGCGGGCGGCTTCGCCGCGAACCCGGCGAACCCGGCGAACACCGCGCGCGCACCGTCCG
CATCGTCCCGATCGTCGCCATCGCCCGCGCCGGGCGCATCGGCCCCATCGGGCACGCCGGATGCCGGATTGCCCCGCCGC
ATCGGCGCGTGCTGGGGCGATCCCGCGCGCGACGGCGGCATGCGCCCTTGA