Detailed information of component protein


Summary

Component ID T6CP000753
Component protein type TssC
T6SS ID (Type) T6SS00084 experimental (Type i1)
Strain Aliivibrio fischeri ES114
Replicon chromosome I
Sequence Protein sequence (492 a.a.); Nucleotide sequence (1476 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VF_RS05235
Coordinate (Strand) 1107697..1109172 (-)
NCBI ID WP_011261636.1
RefSeq NC_006840
Uniprot ID Q5E648_ALIF1, B5FD89_ALIFM, A0A6N3YWE2_ALIFS
KEGG ID vfi:VF_1003, vfm:VFMJ11_1086
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 4.1e-133 65..364
VipB_2 PF18945.2 5.3e-45 378..488

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-491 MSDTSTAQELDNQVTVGLLDQIVAQTNLTPEDETYGIAKRGVSAFIEELLKPQNQEEPVKKALIDKMITEIDQRLSKQVDEILHHSSFQQLESAWRGLKLLVDRTDFRENIKIEVINVSKTDLLEDFEDASEITQSGLYKHVYTNEFGTFGGQPVGAIIGNYDFGPSAPDIKNLQNLASVAAMSHAPFISAAGPKFFGLESFEGLPDLKDLNDHFESPQYAKWQSFREQEDSRYVGLTLPRFLLRQPYDPEENPVKAFNYHENVSATHEDYLWGNTAFTMATRITESFANFRWCPNIIGPQSGGAVEDLPLHHFESMGDIETKIPTEVLVSDRREYELAEEGFIALTMRKGSDNAAFFSANSVQKAKFFGNTEEGKNAELNFRLGTQLPYLFIISRLAHYIKVLQREQIGSWKERTDLEQELNTWIRQYIADQENPPAEVRSRRPLRAANIEVMDVEGNPGWYKVNLSVRPHFKYMGSDFTLSLVGKLDQE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9954 - -



  Protein sequence: 492 a.a.    

>T6CP000753 NC_006840:c1109172-1107697 [Aliivibrio fischeri ES114] [TssC]
MSDTSTAQELDNQVTVGLLDQIVAQTNLTPEDETYGIAKRGVSAFIEELLKPQNQEEPVKKALIDKMITEIDQRLSKQVD
EILHHSSFQQLESAWRGLKLLVDRTDFRENIKIEVINVSKTDLLEDFEDASEITQSGLYKHVYTNEFGTFGGQPVGAIIG
NYDFGPSAPDIKNLQNLASVAAMSHAPFISAAGPKFFGLESFEGLPDLKDLNDHFESPQYAKWQSFREQEDSRYVGLTLP
RFLLRQPYDPEENPVKAFNYHENVSATHEDYLWGNTAFTMATRITESFANFRWCPNIIGPQSGGAVEDLPLHHFESMGDI
ETKIPTEVLVSDRREYELAEEGFIALTMRKGSDNAAFFSANSVQKAKFFGNTEEGKNAELNFRLGTQLPYLFIISRLAHY
IKVLQREQIGSWKERTDLEQELNTWIRQYIADQENPPAEVRSRRPLRAANIEVMDVEGNPGWYKVNLSVRPHFKYMGSDF
TLSLVGKLDQE*

  Nucleotide sequence: 1476 bp    

>T6CP000753 NC_006840:c1109172-1107697 [Aliivibrio fischeri ES114] [TssC]
ATGTCAGATACAAGCACAGCACAAGAGCTAGATAATCAAGTTACTGTTGGACTTCTTGATCAAATCGTAGCTCAAACCAA
TTTAACTCCAGAAGATGAAACATACGGTATTGCTAAGCGTGGTGTCAGCGCTTTTATTGAAGAGTTATTAAAACCTCAGA
ATCAAGAAGAGCCAGTCAAAAAAGCTTTAATTGATAAAATGATCACAGAGATTGATCAACGCTTAAGTAAACAAGTGGAC
GAAATTCTTCACCACTCGTCTTTTCAACAACTTGAATCTGCTTGGCGTGGATTAAAATTACTCGTTGACCGCACCGATTT
TCGTGAAAATATTAAAATCGAAGTGATTAATGTATCTAAAACTGACTTGTTAGAGGACTTCGAAGATGCTTCAGAAATTA
CTCAATCAGGACTCTACAAGCATGTCTACACTAACGAGTTTGGTACATTTGGTGGCCAACCTGTTGGTGCTATTATTGGT
AATTATGACTTTGGTCCTTCTGCGCCTGATATTAAAAACCTTCAAAACTTGGCTTCTGTAGCAGCAATGTCTCATGCACC
ATTTATTTCAGCCGCAGGCCCTAAATTCTTTGGCTTAGAATCATTTGAGGGATTACCTGATCTAAAAGATCTTAATGATC
ATTTTGAAAGTCCTCAATATGCAAAATGGCAAAGCTTCCGTGAACAAGAAGACTCAAGATATGTAGGTTTAACATTACCT
AGATTCTTATTACGTCAACCTTATGATCCAGAAGAAAACCCTGTAAAAGCATTCAATTACCATGAAAATGTTTCTGCTAC
TCACGAAGATTATTTATGGGGAAATACCGCTTTTACAATGGCAACTCGTATCACTGAAAGTTTTGCTAATTTCCGTTGGT
GTCCAAATATTATTGGTCCTCAATCAGGTGGTGCAGTGGAAGACCTACCTCTCCACCACTTTGAAAGTATGGGTGATATT
GAAACTAAGATCCCAACAGAAGTTCTTGTTTCCGACCGCAGAGAATATGAATTAGCAGAAGAAGGCTTTATTGCTCTCAC
CATGCGCAAAGGCTCAGATAATGCGGCTTTCTTCTCTGCTAACTCTGTTCAAAAAGCAAAGTTTTTCGGTAATACAGAAG
AAGGCAAAAACGCTGAGTTAAATTTCCGTTTGGGTACGCAGCTCCCTTACTTGTTCATTATTAGCCGCCTTGCACATTAC
ATTAAGGTGCTACAACGTGAACAAATCGGTAGTTGGAAAGAACGTACAGACTTAGAGCAAGAGTTAAACACTTGGATTCG
TCAATACATTGCTGATCAAGAAAATCCACCAGCTGAAGTTCGTAGCCGTCGTCCACTTCGTGCAGCAAATATCGAAGTAA
TGGACGTTGAAGGAAATCCAGGCTGGTACAAAGTAAACCTATCAGTTCGCCCACACTTCAAATACATGGGTTCTGATTTT
ACGTTGTCGCTAGTTGGTAAATTGGATCAAGAGTAA