Detailed information of component protein


Summary

Component ID T6CP000748
Component protein type TssK
T6SS ID (Type) T6SS00084 experimental (Type i1)
Strain Aliivibrio fischeri ES114
Replicon chromosome I
Sequence Protein sequence (441 a.a.); Nucleotide sequence (1323 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VF_RS05195
Coordinate (Strand) 1096970..1098292 (-)
NCBI ID WP_011261628.1
RefSeq NC_006840
Uniprot ID Q5E656_ALIF1, B5FD80_ALIFM
KEGG ID vfm:VFMJ11_1077, vfi:VF_0995
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1.1e-129 16..437

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-440 MQKVIWKEGMLLRPQHFQQSDRYYQNQLQVRTQKQHRFNWGFHSLSFDNHHLSVGKIVISQASGILPDGSLFDIQHQTTPIVWESDAPKTNLNLYLAISLSTINSPEARDEKETEINTRYVSHDLTISDNNAQVQNLQTISCGELDFHIITEEEIDNHWVKIKLCEIKQVTPEGAIQLNPNFEASFINGVHSSLVHRSLREVLTLVTHKADILAERITKSGHATSEIGDFLLLQLLNKYEPQLHYLNKCSQYHPEELFLLLSSLQGELSTYDSGHRRPDLKLSYNHKEQGESFDQILFHLRKQLNQSLKQNAFEIPLQKRNHGVLIAPISDDSLLQEATFILAARSHTDAESLRKQLPPQLKVGPVEKIRNLVNLQLPGITCRSLSVAPRQVPFHGDYCYFTLDLTSNDRSQLTQSGGFAFHIAGDFPELSLFFWAIRNS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9845 - -



  Protein sequence: 441 a.a.    

>T6CP000748 NC_006840:c1098292-1096970 [Aliivibrio fischeri ES114] [TssK]
MQKVIWKEGMLLRPQHFQQSDRYYQNQLQVRTQKQHRFNWGFHSLSFDNHHLSVGKIVISQASGILPDGSLFDIQHQTTP
IVWESDAPKTNLNLYLAISLSTINSPEARDEKETEINTRYVSHDLTISDNNAQVQNLQTISCGELDFHIITEEEIDNHWV
KIKLCEIKQVTPEGAIQLNPNFEASFINGVHSSLVHRSLREVLTLVTHKADILAERITKSGHATSEIGDFLLLQLLNKYE
PQLHYLNKCSQYHPEELFLLLSSLQGELSTYDSGHRRPDLKLSYNHKEQGESFDQILFHLRKQLNQSLKQNAFEIPLQKR
NHGVLIAPISDDSLLQEATFILAARSHTDAESLRKQLPPQLKVGPVEKIRNLVNLQLPGITCRSLSVAPRQVPFHGDYCY
FTLDLTSNDRSQLTQSGGFAFHIAGDFPELSLFFWAIRNS*

  Nucleotide sequence: 1323 bp    

>T6CP000748 NC_006840:c1098292-1096970 [Aliivibrio fischeri ES114] [TssK]
ATGCAAAAAGTTATATGGAAAGAAGGCATGCTATTGCGGCCTCAACATTTCCAACAAAGTGATCGTTACTATCAAAATCA
ACTGCAAGTACGCACGCAGAAGCAACACAGGTTTAATTGGGGTTTCCATTCTCTGAGCTTTGATAATCATCATTTATCTG
TTGGAAAGATAGTGATCAGTCAAGCTAGTGGTATTTTACCCGATGGTTCACTATTTGATATTCAACATCAAACAACCCCT
ATTGTTTGGGAGTCTGATGCGCCTAAAACAAACTTAAATCTGTATTTAGCGATTTCTTTATCGACTATCAATAGTCCGGA
AGCTCGCGATGAAAAAGAAACCGAAATTAACACTCGTTATGTTTCTCACGATTTAACCATTTCAGATAATAATGCCCAAG
TACAAAACTTGCAGACTATCAGTTGTGGTGAGTTAGATTTTCATATTATTACCGAAGAAGAGATTGATAATCATTGGGTT
AAAATCAAACTATGTGAAATTAAACAAGTCACTCCAGAAGGTGCGATCCAACTCAACCCTAATTTTGAAGCGAGTTTTAT
CAATGGTGTTCACTCGTCTCTTGTTCATCGTTCGCTACGAGAAGTCTTAACTCTCGTTACTCATAAAGCCGATATTTTAG
CCGAACGTATTACCAAATCAGGACACGCAACCTCAGAAATTGGTGACTTCTTATTGCTTCAATTATTAAATAAGTACGAG
CCTCAACTCCACTATCTAAATAAGTGCTCTCAATACCATCCGGAGGAGCTCTTTTTATTACTTTCATCTTTGCAAGGAGA
GTTGTCTACTTATGATTCAGGTCATCGTCGACCAGATCTAAAATTATCATACAATCATAAAGAACAAGGCGAGTCATTTG
ATCAGATCTTATTTCATTTGCGTAAACAGCTGAATCAGTCATTGAAACAAAACGCCTTTGAGATACCACTACAAAAACGC
AATCACGGTGTACTTATTGCCCCTATTTCTGATGATAGCTTATTGCAAGAAGCCACCTTTATTCTCGCGGCTCGCTCTCA
TACCGACGCTGAAAGCTTACGAAAACAACTGCCACCACAATTAAAAGTCGGACCTGTTGAAAAAATTCGCAACCTTGTAA
ACCTTCAATTACCGGGGATCACTTGTCGCTCACTTTCTGTAGCCCCAAGACAAGTCCCTTTCCATGGTGATTATTGTTAT
TTCACCCTTGATTTAACCTCAAACGATCGCTCTCAACTAACGCAATCTGGAGGATTTGCCTTCCATATTGCAGGTGATTT
CCCTGAGCTTTCTCTTTTCTTTTGGGCAATAAGGAATAGTTAA