Detailed information of component protein


Summary

Component ID T6CP000114
Component protein type TssM
T6SS ID (Type) T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome linear
Sequence Protein sequence (1160 a.a.); Nucleotide sequence (3480 bp)
Reference
[1] Ma LS, Narberhaus F, Lai EM. IcmF family protein TssM exhibits ATPase activity and energizes type VI secretion. J Biol Chem. 2012 May 4;287(19):15610-21. doi: 10.1074/jbc.M111.301630. Epub 2012 Mar 5. PMID: 22393043
[2] Wu HY, Chung PC, Shih HW, et al. Secretome analysis uncovers an Hcp-family protein secreted via a type VI secretion system in Agrobacterium tumefaciens. J Bacteriol. 2008 Apr;190(8):2841-50. doi: 10.1128/JB.01775-07. Epub 2008 Feb 8. PMID: 18263727
[3] Wu CF, Lin JS, Shaw GC, et al. Acid-induced type VI secretion system is regulated by ExoR-ChvG/ChvI signaling cascade in Agrobacterium tumefaciens. PLoS Pathog. 2012 Sep;8(9):e1002938. doi: 10.1371/journal.ppat.1002938. Epub 2012 Sep 27. PMID: 23028331
[4] Lin JS, Ma LS, Lai EM. Systematic dissection of the agrobacterium type VI secretion system reveals machinery and secreted components for subcomplex formation. PLoS One. 2013 Jul 5;8(7):e67647. doi: 10.1371/journal.pone.0067647. Print 2013. PMID: 23861778
[5] Ma LS, Hachani A, Lin JS, et al. Agrobacterium tumefaciens deploys a superfamily of type VI secretion DNase effectors as weapons for interbacterial competition in planta. Cell Host Microbe. 2014 Jul 9;16(1):94-104. doi: 10.1016/j.chom.2014.06.002. Epub 2014 Jun 26. PMID: 24981331
[6] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308
[7] Lin JS, Wu HH, Hsu PH, et al. Fha interaction with phosphothreonine of TssL activates type VI secretion in Agrobacterium tumefaciens. PLoS Pathog. 2014 Mar 13;10(3):e1003991. doi: 10.1371/journal.ppat.1003991. eCollection 2014 Mar. PMID: 24626341
[8] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308
[9] Ma LS, Lin JS, Lai EM. An IcmF family protein, ImpLM, is an integral inner membrane protein interacting with ImpKL, and its walker a motif is required for type VI secretion system-mediated Hcp secretion in Agrobacterium tumefaciens. J Bacteriol. 2009 Jul;191(13):4316-29. doi: 10.1128/JB.00029-09. Epub 2009 Apr 24. PMID: 19395482
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ATU_RS20285
Coordinate (Strand) 1460756..1464235 (-)
NCBI ID WP_010973755.1
RefSeq NC_003063
Uniprot ID A0A6V7AAH0_RHIRD, A9CGF9_AGRFC
KEGG ID atu:Atu4332
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 2.3e-78 203..442
IcmF-related PF06761.14 9.1e-61 496..793
IcmF_C PF06744.14 6.6e-18 1037..1140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-24 MNPLSYFYTIRSYVESYAALVGRR
Transmembrane helix 25-47 FLSLLWVIALCVVVWFYGYLIAL
Outside 48-56 GDFKPLGTV
Transmembrane helix 57-79 QARLIAIGIIVAVWLVYIIVTIY
Inside 80-432 RGRKQDKELVDSIEREALANRQAEIGEIQTRLKEALALLRRVTKKRFGYIYDLPWYVIFGAPGSGKTTALTNSGLQFPLGDALGENAVKGIGGTRNCNWWFADEAILIDTAGRYTTQDDLDGSSKAGWEGFLGLLRRYRRSQPINGALVTLSIPDLLNRDPEEQRQELRSIRQRLSELDEYLHARVPVYIVLTKADLLHGFVEFFDGFNKTDRQQVWGTTFKLDESYSAENLPQRLTEEFELLQQRVDAMLIERLQQEQNAEIRGRIFRFPAELARLKDRLHEALAELCASSPLIEAPLLRGVYFASGTQPETEKSPAASRTRRSYFLSRLFKDVIFPEAALVTRDKRLSRRQ
Transmembrane helix 433-455 LLVRRIAYAVSATAVAIVFTGWI
Outside 456-1159 FTYFANTQALAEADRKLGAYEQLVQGIPVREVADADFLRILPALDNLRDVNSGFARERVWNVSFGLDQEDKIAGRQRDAYQRALNALLLPRMIVQLQKQLKDEKDVTRTFNSLKLYGMLGGMGGLDRDFLTTQTHQMFASLYPGDGRAAAREALDQHAKALADGVLAPIELDARLIATARETIRDQAIGTRAYDILAGLPQVRELMEWTPATAFGPLGERAFERRSKAPMAEGIEGLFTADGYRRVVIPQVAHAARVALSEGWVRGSDDAIKGATVEQVAQAALQIYFDRFEKIWADTLSDLRVKPSQSLGDAVETTRALANERNIVVEAARSIAEATDLRPGANPAALASAAEGDATAAVLAATVNAADPYARLRDMLATKGAATTGEQPNGDKTGGSPSEQLLAHFKLLNEQLARSATTSDEVAKVFDVDSQLTKANQDLLQQARELPAPLDVWVAGVAADVGSLAVKSARSRIAELWTADSASLCSSIVTGRYPFDRASSRDVAIADFTRLFAPTGVFQSFFKQRMEPFVDKTTTPWSWKGTFGAAGIPSSAVAQFENADKISRAFFPNGSETPTVSINVKPVSLTNASSAVMLEIEGERVVYYHGPIQAKSITWPSRENTASLSRIAFQPGGWQQAKTENGDWSPFRLFDGANIENQSGELLRVRFENGVQAAEFDIQFGSVLNPFKLDAIASFACPAQF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9912 - -



  Protein sequence: 1160 a.a.    

>T6CP000114 NC_003063:c1464235-1460756 [Agrobacterium fabrum str. C58] [TssM]
MNPLSYFYTIRSYVESYAALVGRRFLSLLWVIALCVVVWFYGYLIALGDFKPLGTVQARLIAIGIIVAVWLVYIIVTIYR
GRKQDKELVDSIEREALANRQAEIGEIQTRLKEALALLRRVTKKRFGYIYDLPWYVIFGAPGSGKTTALTNSGLQFPLGD
ALGENAVKGIGGTRNCNWWFADEAILIDTAGRYTTQDDLDGSSKAGWEGFLGLLRRYRRSQPINGALVTLSIPDLLNRDP
EEQRQELRSIRQRLSELDEYLHARVPVYIVLTKADLLHGFVEFFDGFNKTDRQQVWGTTFKLDESYSAENLPQRLTEEFE
LLQQRVDAMLIERLQQEQNAEIRGRIFRFPAELARLKDRLHEALAELCASSPLIEAPLLRGVYFASGTQPETEKSPAASR
TRRSYFLSRLFKDVIFPEAALVTRDKRLSRRQLLVRRIAYAVSATAVAIVFTGWIFTYFANTQALAEADRKLGAYEQLVQ
GIPVREVADADFLRILPALDNLRDVNSGFARERVWNVSFGLDQEDKIAGRQRDAYQRALNALLLPRMIVQLQKQLKDEKD
VTRTFNSLKLYGMLGGMGGLDRDFLTTQTHQMFASLYPGDGRAAAREALDQHAKALADGVLAPIELDARLIATARETIRD
QAIGTRAYDILAGLPQVRELMEWTPATAFGPLGERAFERRSKAPMAEGIEGLFTADGYRRVVIPQVAHAARVALSEGWVR
GSDDAIKGATVEQVAQAALQIYFDRFEKIWADTLSDLRVKPSQSLGDAVETTRALANERNIVVEAARSIAEATDLRPGAN
PAALASAAEGDATAAVLAATVNAADPYARLRDMLATKGAATTGEQPNGDKTGGSPSEQLLAHFKLLNEQLARSATTSDEV
AKVFDVDSQLTKANQDLLQQARELPAPLDVWVAGVAADVGSLAVKSARSRIAELWTADSASLCSSIVTGRYPFDRASSRD
VAIADFTRLFAPTGVFQSFFKQRMEPFVDKTTTPWSWKGTFGAAGIPSSAVAQFENADKISRAFFPNGSETPTVSINVKP
VSLTNASSAVMLEIEGERVVYYHGPIQAKSITWPSRENTASLSRIAFQPGGWQQAKTENGDWSPFRLFDGANIENQSGEL
LRVRFENGVQAAEFDIQFGSVLNPFKLDAIASFACPAQF*

  Nucleotide sequence: 3480 bp    

>T6CP000114 NC_003063:c1464235-1460756 [Agrobacterium fabrum str. C58] [TssM]
ATGAATCCATTGAGCTATTTTTATACGATCCGTTCCTATGTCGAGAGCTATGCGGCCCTCGTCGGCCGGCGTTTCCTCTC
GCTTTTATGGGTGATCGCGCTCTGCGTCGTCGTCTGGTTCTACGGCTATCTGATCGCGCTCGGCGATTTCAAACCGCTTG
GAACGGTGCAGGCGCGGCTCATCGCCATCGGCATCATCGTCGCCGTCTGGCTGGTCTACATCATCGTCACGATCTACCGC
GGCCGCAAACAGGACAAGGAACTCGTCGACAGTATCGAGCGCGAGGCGCTGGCCAATCGGCAGGCGGAAATCGGCGAAAT
CCAGACCCGCCTGAAAGAAGCGCTCGCGCTCTTGCGGCGCGTCACGAAAAAGCGCTTCGGTTACATTTACGACTTGCCCT
GGTACGTGATCTTCGGCGCACCCGGCTCCGGCAAGACGACGGCGCTGACCAATTCCGGCCTGCAATTTCCGCTTGGCGAT
GCGCTCGGTGAAAATGCGGTGAAGGGTATCGGTGGCACGCGCAACTGTAACTGGTGGTTCGCGGACGAGGCGATCCTTAT
CGACACTGCCGGTCGCTATACCACCCAGGATGACCTCGACGGTTCCTCGAAGGCCGGCTGGGAAGGCTTTCTTGGCCTTT
TGAGGCGATATCGTCGTTCGCAGCCGATCAATGGCGCATTGGTCACGCTGTCCATTCCCGATCTGCTCAACCGCGATCCC
GAAGAACAGCGGCAGGAGCTGCGCTCCATCCGCCAGCGTCTTTCGGAACTTGACGAATATCTGCATGCCCGCGTTCCGGT
CTATATCGTCCTGACGAAAGCCGACCTGCTGCATGGTTTCGTGGAATTTTTCGATGGATTCAACAAGACCGACCGCCAGC
AGGTGTGGGGCACCACCTTCAAGCTGGATGAGAGCTACTCCGCCGAAAACCTGCCGCAGCGTCTGACGGAAGAATTCGAA
CTGCTACAGCAGCGGGTCGATGCCATGCTGATCGAACGCCTGCAGCAGGAGCAGAATGCGGAAATACGCGGCCGTATCTT
CCGTTTTCCAGCCGAACTCGCGCGGCTGAAAGATCGCCTGCACGAGGCCCTTGCCGAACTTTGCGCAAGTTCGCCTCTCA
TCGAGGCGCCGCTTCTGCGCGGCGTTTATTTCGCGTCGGGAACGCAGCCGGAAACGGAAAAATCTCCCGCGGCATCCAGA
ACCCGCCGCAGCTATTTCCTGTCGCGGTTGTTCAAGGACGTCATCTTCCCTGAAGCCGCCCTGGTGACGCGTGACAAGCG
CCTTTCCCGGCGGCAATTGCTGGTGCGGCGCATTGCTTATGCCGTATCCGCCACGGCGGTCGCCATCGTCTTCACCGGCT
GGATTTTCACCTATTTCGCCAATACGCAGGCGCTGGCCGAAGCGGATCGCAAACTTGGCGCTTATGAGCAGCTCGTTCAG
GGAATTCCCGTGCGCGAGGTCGCGGACGCCGATTTCCTGCGGATCCTCCCCGCGCTCGACAATCTGCGCGATGTCAATTC
CGGCTTTGCCCGCGAACGCGTGTGGAATGTCAGCTTCGGTCTTGATCAGGAAGACAAGATTGCCGGCCGGCAGCGTGACG
CCTATCAGCGCGCACTCAACGCCCTTCTGCTGCCGCGCATGATCGTGCAGCTGCAAAAGCAGCTGAAGGACGAAAAGGAT
GTCACCCGCACGTTCAATTCGCTGAAACTCTACGGAATGCTGGGCGGGATGGGTGGTCTGGACCGCGATTTCCTGACCAC
GCAGACGCATCAGATGTTCGCATCCCTTTATCCCGGTGACGGAAGGGCGGCGGCGAGAGAAGCGCTTGACCAGCATGCAA
AGGCGCTCGCTGACGGCGTGCTCGCCCCGATCGAGCTCGATGCGCGGCTCATCGCCACCGCCCGCGAAACCATCCGCGAT
CAGGCGATTGGCACACGCGCCTATGATATTCTCGCCGGCCTTCCGCAAGTGCGGGAATTGATGGAATGGACACCCGCTAC
GGCTTTCGGCCCGCTGGGGGAGCGTGCTTTCGAGCGTCGCAGCAAAGCGCCGATGGCCGAGGGGATAGAGGGCCTTTTCA
CCGCCGATGGATATCGCCGCGTTGTCATCCCGCAGGTCGCGCATGCGGCCCGCGTCGCGCTTTCCGAAGGATGGGTGCGC
GGTTCTGACGATGCCATCAAGGGTGCGACTGTCGAGCAAGTGGCGCAGGCCGCGCTGCAAATCTATTTCGACAGGTTCGA
GAAAATATGGGCCGACACGCTGTCCGATCTGCGCGTCAAACCATCCCAGAGCCTCGGCGACGCGGTGGAGACAACACGGG
CTCTTGCCAATGAGCGCAATATCGTGGTGGAGGCTGCCAGATCGATCGCAGAGGCGACCGATCTCCGCCCCGGAGCAAAC
CCCGCCGCCCTCGCCTCCGCTGCGGAAGGAGACGCAACCGCAGCCGTTCTGGCCGCTACGGTGAATGCGGCCGATCCCTA
TGCGAGACTGCGCGACATGCTGGCGACGAAAGGCGCAGCTACAACGGGCGAGCAGCCCAATGGCGACAAGACCGGTGGTT
CGCCATCGGAACAGTTACTCGCGCATTTCAAGCTGCTGAACGAACAGCTTGCCCGTTCGGCAACCACCTCCGATGAGGTC
GCCAAGGTGTTCGACGTGGACAGCCAGCTCACCAAGGCCAATCAGGATCTGTTGCAGCAGGCACGCGAATTGCCGGCACC
GCTCGACGTCTGGGTGGCAGGCGTGGCGGCGGATGTCGGCTCGCTCGCGGTCAAGTCCGCACGCAGCCGCATCGCCGAAC
TCTGGACGGCCGATTCAGCCTCCCTGTGCTCCTCGATCGTGACCGGTCGTTATCCCTTCGACCGAGCCTCCTCCCGCGAT
GTCGCGATTGCGGATTTTACCCGTCTCTTCGCGCCGACGGGGGTTTTCCAGAGCTTCTTCAAACAGCGCATGGAACCGTT
TGTCGACAAGACGACGACCCCATGGAGCTGGAAAGGCACCTTCGGCGCCGCCGGCATTCCCAGCAGCGCCGTCGCCCAGT
TCGAAAATGCCGACAAGATTTCGCGCGCCTTTTTCCCGAATGGCAGCGAGACGCCGACGGTTTCGATCAATGTCAAACCC
GTCTCGCTCACCAATGCCTCCAGCGCGGTGATGCTGGAAATCGAAGGCGAGCGGGTCGTTTATTATCATGGACCGATCCA
GGCGAAATCGATTACCTGGCCCTCGCGCGAAAACACGGCGAGCCTGTCGCGCATCGCCTTCCAGCCGGGCGGCTGGCAGC
AGGCGAAGACCGAAAACGGCGACTGGTCGCCCTTCCGGCTGTTTGACGGTGCCAATATCGAAAATCAGTCGGGTGAGCTG
TTGCGGGTGCGGTTTGAGAATGGCGTCCAGGCTGCCGAGTTCGATATTCAGTTCGGCTCGGTTCTCAATCCATTCAAGCT
GGATGCGATTGCCAGCTTCGCCTGCCCTGCGCAGTTCTAG