Detailed information of component protein

Summary

Component ID	T6CP000016
Component protein type	TssJ
T6SS ID (Type)	T6SS00004 (Type i1)
Strain	Pseudomonas aeruginosa PAO1
Replicon	chromosome (H2-T6SS)
Sequence	Protein sequence (169 a.a.); Nucleotide sequence (507 bp)
Reference	[1] Sana TG, Hachani A, Bucior I, et al. The second type VI secretion system of Pseudomonas aeruginosa strain PAO1 is regulated by quorum sensing and Fur and modulates internalization in epithelial cells. J Biol Chem. 2012 Aug 3;287(32):27095-105. doi: 10.1074/jbc.M112.376368. Epub 2012 Jun 4. PMID: 22665491 [2] Osipiuk J, Xu X, Cui H, et al. Crystal structure of secretory protein Hcp3 from Pseudomonas aeruginosa. J Struct Funct Genomics. 2011 Mar;12(1):21-6. doi: 10.1007/s10969-011-9107-1. Epub 2011 Apr 8. PMID: 21476004 [3] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537 [4] Hachani A, Lossi NS, Hamilton A, et al. Type VI secretion system in Pseudomonas aeruginosa: secretion and multimerization of VgrG proteins. J Biol Chem. 2011 Apr 8;286(14):12317-27. doi: 10.1074/jbc.M110.193045. Epub 2011 Feb 16. PMID: 21325275 [5] Bleves S, Viarre V, Salacha R, et al. Protein secretion systems in Pseudomonas aeruginosa: A wealth of pathogenic weapons. Int J Med Microbiol. 2010 Dec;300(8):534-43. doi: 10.1016/j.ijmm.2010.08.005. Epub 2010 Oct 13. PMID: 20947426 [6] Russell AB, LeRoux M, Hathazi K, et al. Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 2013 Apr 25;496(7446):508-12. doi: 10.1038/nature12074. Epub 2013 Apr 3. PMID: 23552891 [7] Sana TG, Soscia C, Tonglet CM, et al. Divergent control of two type VI secretion systems by RpoN in Pseudomonas aeruginosa. PLoS One. 2013 Oct 21;8(10):e76030. doi: 10.1371/journal.pone.0076030. eCollection 2013. PMID: 24204589 [8] Jiang F, Waterfield NR, Yang J, et al. A Pseudomonas aeruginosa type VI secretion phospholipase D effector targets both prokaryotic and eukaryotic cells. Cell Host Microbe. 2014 May 14;15(5):600-10. doi: 10.1016/j.chom.2014.04.010. PMID: 24832454 [9] Sana TG, Baumann C, Merdes A, et al. Internalization of Pseudomonas aeruginosa Strain PAO1 into Epithelial Cells Is Promoted by Interaction of a T6SS Effector with the Microtubule Network. mBio. 2015 Jun 2;6(3):e00712. doi: 10.1128/mBio.00712-15. PMID: 26037124

Experimental investigation has been performed on this T6SS

---

External database links

Locus tag (Gene)	PA1666
Coordinate (Strand)	1816352..1816858 (+)
NCBI ID	NP_250357.1
RefSeq	NC_002516
Uniprot ID	Q9I359_PSEAE
KEGG ID	pae:PA1666
PDB ID	-

---

Pfam domain hit(s)

Domain	Pfam ID	E-value	Aligned region
T6SS-SciN	PF12790.9	9.4e-41	34..151

---

Transmembrane helices

• Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Inside	1-11	MSRRPIPPARA
Transmembrane helix	12-31	LAMLAVLALLAGCSTLSPYS
Outside	32-168	RLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAKELTRVELKLGQKGILNAGELLGKAGDAR

---

Signal peptides

Prediction	Probability	Cleavage site	Signal peptide sequence
LIPO(Sec/SPII)	0.9983	pos: 23-24. LAG-CS.	MSRRPIPPARALAMLAVLALLAG

---

  Protein sequence: 169 a.a.    Download


  Nucleotide sequence: 507 bp    Download