Detailed information of component protein


Summary

Component ID T6CP000016
Component protein type TssJ
T6SS ID (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome (H2-T6SS)
Sequence Protein sequence (169 a.a.); Nucleotide sequence (507 bp)
Reference
[1] Sana TG, Hachani A, Bucior I, et al. The second type VI secretion system of Pseudomonas aeruginosa strain PAO1 is regulated by quorum sensing and Fur and modulates internalization in epithelial cells. J Biol Chem. 2012 Aug 3;287(32):27095-105. doi: 10.1074/jbc.M112.376368. Epub 2012 Jun 4. PMID: 22665491
[2] Osipiuk J, Xu X, Cui H, et al. Crystal structure of secretory protein Hcp3 from Pseudomonas aeruginosa. J Struct Funct Genomics. 2011 Mar;12(1):21-6. doi: 10.1007/s10969-011-9107-1. Epub 2011 Apr 8. PMID: 21476004
[3] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537
[4] Hachani A, Lossi NS, Hamilton A, et al. Type VI secretion system in Pseudomonas aeruginosa: secretion and multimerization of VgrG proteins. J Biol Chem. 2011 Apr 8;286(14):12317-27. doi: 10.1074/jbc.M110.193045. Epub 2011 Feb 16. PMID: 21325275
[5] Bleves S, Viarre V, Salacha R, et al. Protein secretion systems in Pseudomonas aeruginosa: A wealth of pathogenic weapons. Int J Med Microbiol. 2010 Dec;300(8):534-43. doi: 10.1016/j.ijmm.2010.08.005. Epub 2010 Oct 13. PMID: 20947426
[6] Russell AB, LeRoux M, Hathazi K, et al. Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 2013 Apr 25;496(7446):508-12. doi: 10.1038/nature12074. Epub 2013 Apr 3. PMID: 23552891
[7] Sana TG, Soscia C, Tonglet CM, et al. Divergent control of two type VI secretion systems by RpoN in Pseudomonas aeruginosa. PLoS One. 2013 Oct 21;8(10):e76030. doi: 10.1371/journal.pone.0076030. eCollection 2013. PMID: 24204589
[8] Jiang F, Waterfield NR, Yang J, et al. A Pseudomonas aeruginosa type VI secretion phospholipase D effector targets both prokaryotic and eukaryotic cells. Cell Host Microbe. 2014 May 14;15(5):600-10. doi: 10.1016/j.chom.2014.04.010. PMID: 24832454
[9] Sana TG, Baumann C, Merdes A, et al. Internalization of Pseudomonas aeruginosa Strain PAO1 into Epithelial Cells Is Promoted by Interaction of a T6SS Effector with the Microtubule Network. mBio. 2015 Jun 2;6(3):e00712. doi: 10.1128/mBio.00712-15. PMID: 26037124
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PA1666
Coordinate (Strand) 1816352..1816858 (+)
NCBI ID NP_250357.1
RefSeq NC_002516
Uniprot ID Q9I359_PSEAE
KEGG ID pae:PA1666
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 9.4e-41 34..151

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-11 MSRRPIPPARA
Transmembrane helix 12-31 LAMLAVLALLAGCSTLSPYS
Outside 32-168 RLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAKELTRVELKLGQKGILNAGELLGKAGDAR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9983 pos: 23-24. LAG-CS. MSRRPIPPARALAMLAVLALLAG



  Protein sequence: 169 a.a.    

>T6CP000016 NC_002516:1816352-1816858 [Pseudomonas aeruginosa PAO1] [TssJ]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAFENADFFSLYE
RPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAKELTRVELKLGQKGILNAGEL
LGKAGDAR*

  Nucleotide sequence: 507 bp    

>T6CP000016 NC_002516:1816352-1816858 [Pseudomonas aeruginosa PAO1] [TssJ]
ATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCTGTTCCACGCT
GTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAATCCCGACCTCAATGGCCGGC
CGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCGGTGGCGTTCGAGAACGCCGACTTCTTCAGCCTCTACGAA
CGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCGAGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAA
GCTCAGCGTGGAGGAGGGGAGCCGCTACGTGGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACG
TGGTGCCGGTCACGGCGAAAGAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAATTG
CTCGGCAAGGCGGGTGACGCGCGATGA