Detailed information of accessory protein


Summary

Accessory protein ID ACP44070 experimental
Type adaptor
Related T6SS (Type) T6SS17510 (Type Unknown)
Strain Burkholderia glumae BGR1
Replicon chromosome
Related structure protein -
Related effector -
Description In contrast, Δu2g07420DUF2169 and Δu2g07420PPR did exhibit attenuated virulence in rice plants. These results suggest that the pentapeptide repeats region of the C-terminal additional domain, as well as the DUF2169 domain, is required for complete functioning of the DUF2169 domain-containing protein encoded by bglu_2g07420.
Reference [1] Kim N, Han G, Jung H, et al. T6SS Accessory Proteins, Including DUF2169 Domain-Containing Protein and Pentapeptide Repeats Protein, Contribute to Bacterial Virulence in T6SS Group_5 of Burkholderia glumae BGR1. Plants (Basel). 2021 Dec 23;11(1). pii: 34. doi: 10.3390/plants11010034. PMID: 35009038
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BGLU_RS21515
Coordinates (Strand) 888978..891614 (-)
NCBI ID WP_012733555.1
RefSeq NC_012721
Uniprot ID A0A2J9HJ00_BURGL, C5AMW0_BURGB
KEGG ID bgl:bglu_2g07420
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF2169 PF09937.11 1.3e-73 20..307
Pentapeptide PF00805.24 1.8e-11 605..642
Pentapeptide_4 PF13599.8 4.5e-06 801..863

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-878 MKIIKPQSLGLLQKPYTHLGRHRLSVAVIGFFPLGRTSERFLAENQQWPHVLASLPAGQPLDEAMPRQGAEVLLLGSAYAPQRKAATSVDVQLRLDDRAGQPLVSKCLCVCGEREWRAPALGGRRVGQPKPFLAMPLSYARAFGGARHAANPAGCGSRASWFGKGRGAMPNVAYPPNAADPAWRASVPAGFGPIPIGNRARLRKFGSYGSQWLKHDAPGFARDLDWSVFNMAPPDQWTKAPFQGGERYTLRHLHPQHAELSGTLPGLAARGFVLRAGEAPEQAREVPLAMDAVWFVPDYDLGVAVYHGTLEIGDGDGLDVDTLMVGYEHRDRPKPLAHYHDVLRLRLDPEAARLHAFNDSQLAPQRSEAEQARRAREQQAAEQAVLARDQRRLDLLDQQYWARRGKARPAGHQVAQARLPALGLMTSQTAAEGDFDLSEIVLKAKALAADAEQRGLAALAKLPARPAAAVDAAKLLADALERAARPAYDLLAPEQAGRDPQVASMLAKLAAPAADAGPKQHERHQHARDAVLKIPALRRQARRSAPKPTLAALPYPADVARRLGEQIRQWHAAGVVLAGRDLAGADLAGLDFSGADLREAMLDGADLSGAKFVGAKLQGAVLVGARLDHADFSGADLTRANLCMSSGRAISFDGAELGHAQAIDAQWPQASLRGARLGRLLGLRLACPGAVFDEADASKATLFDLAAEDSRWHAARLEKTVFMRARLTRAGFAGARLTKTVFTMSDLQASRWEGARLDGVQGGTRSIWRDAVMSGVTARNSGFAGADLSHADLEAASFLRCDFGQAELRGARLVAGLFSHCGFYASRLRMVEASGAEFYQCTCRKTDFTGARLVDAVFAQCEQTGAIPPQGVTTGSPA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8903 - -



  Protein sequence: 879 a.a.    

>ACP44070 NC_012721:c891614-888978 [Burkholderia glumae BGR1]
MKIIKPQSLGLLQKPYTHLGRHRLSVAVIGFFPLGRTSERFLAENQQWPHVLASLPAGQPLDEAMPRQGAEVLLLGSAYA
PQRKAATSVDVQLRLDDRAGQPLVSKCLCVCGEREWRAPALGGRRVGQPKPFLAMPLSYARAFGGARHAANPAGCGSRAS
WFGKGRGAMPNVAYPPNAADPAWRASVPAGFGPIPIGNRARLRKFGSYGSQWLKHDAPGFARDLDWSVFNMAPPDQWTKA
PFQGGERYTLRHLHPQHAELSGTLPGLAARGFVLRAGEAPEQAREVPLAMDAVWFVPDYDLGVAVYHGTLEIGDGDGLDV
DTLMVGYEHRDRPKPLAHYHDVLRLRLDPEAARLHAFNDSQLAPQRSEAEQARRAREQQAAEQAVLARDQRRLDLLDQQY
WARRGKARPAGHQVAQARLPALGLMTSQTAAEGDFDLSEIVLKAKALAADAEQRGLAALAKLPARPAAAVDAAKLLADAL
ERAARPAYDLLAPEQAGRDPQVASMLAKLAAPAADAGPKQHERHQHARDAVLKIPALRRQARRSAPKPTLAALPYPADVA
RRLGEQIRQWHAAGVVLAGRDLAGADLAGLDFSGADLREAMLDGADLSGAKFVGAKLQGAVLVGARLDHADFSGADLTRA
NLCMSSGRAISFDGAELGHAQAIDAQWPQASLRGARLGRLLGLRLACPGAVFDEADASKATLFDLAAEDSRWHAARLEKT
VFMRARLTRAGFAGARLTKTVFTMSDLQASRWEGARLDGVQGGTRSIWRDAVMSGVTARNSGFAGADLSHADLEAASFLR
CDFGQAELRGARLVAGLFSHCGFYASRLRMVEASGAEFYQCTCRKTDFTGARLVDAVFAQCEQTGAIPPQGVTTGSPA*

  Nucleotide sequence: 2637 bp    

>ACP44070 NC_012721:c891614-888978 [Burkholderia glumae BGR1]
ATGAAAATCATCAAACCCCAATCGCTCGGCCTGCTGCAGAAGCCCTACACCCACCTCGGCCGGCATCGGCTGTCGGTGGC
CGTGATCGGCTTCTTCCCGCTCGGCCGGACCAGCGAGCGCTTCCTCGCCGAGAACCAGCAATGGCCGCACGTGCTGGCGA
GCCTGCCGGCCGGCCAGCCGCTCGACGAGGCGATGCCGCGCCAGGGCGCCGAGGTGCTGCTGCTCGGCTCGGCCTACGCG
CCGCAGCGCAAGGCCGCCACCAGCGTGGACGTGCAGCTGCGGCTCGACGACCGCGCCGGCCAGCCGCTCGTCAGCAAGTG
CCTGTGCGTGTGCGGCGAGCGCGAATGGCGCGCGCCGGCGCTGGGCGGGCGCCGCGTCGGCCAGCCCAAGCCGTTCCTCG
CGATGCCGCTCAGCTATGCGCGCGCGTTCGGCGGCGCGCGCCACGCGGCCAACCCGGCCGGCTGCGGCAGCCGTGCGTCG
TGGTTCGGCAAGGGCCGCGGCGCGATGCCGAACGTCGCCTACCCGCCCAACGCGGCGGATCCCGCCTGGCGCGCCAGCGT
GCCGGCCGGCTTCGGGCCGATCCCGATCGGCAACCGCGCGCGGCTGCGCAAGTTCGGCAGCTACGGCAGCCAGTGGCTCA
AGCACGACGCGCCCGGCTTCGCGCGCGACCTCGACTGGAGCGTGTTCAACATGGCGCCGCCCGACCAGTGGACGAAGGCG
CCGTTCCAGGGCGGCGAGCGCTACACGCTGCGGCATCTGCATCCGCAGCACGCCGAGCTGTCCGGCACCCTGCCCGGGCT
GGCCGCGCGCGGCTTCGTGCTGCGCGCCGGCGAGGCGCCCGAGCAGGCCCGCGAGGTGCCGCTCGCGATGGATGCCGTCT
GGTTCGTGCCCGACTACGACCTCGGCGTCGCGGTCTATCACGGCACGCTCGAGATCGGCGACGGCGACGGGCTCGACGTC
GACACGCTGATGGTCGGCTACGAACACCGCGACCGCCCGAAGCCCCTGGCGCACTACCACGACGTGCTGCGGCTGCGCCT
CGACCCCGAGGCGGCCCGCCTGCACGCGTTCAACGACAGCCAGCTCGCGCCGCAGCGTTCCGAGGCCGAGCAGGCGCGCC
GCGCCCGCGAGCAGCAAGCGGCCGAGCAGGCCGTGCTGGCGCGCGACCAGCGCCGCCTCGACCTGCTCGACCAGCAATAC
TGGGCGCGCCGCGGCAAGGCCCGGCCGGCCGGCCATCAGGTCGCGCAAGCCCGGCTGCCGGCGCTCGGCCTGATGACCTC
GCAGACGGCGGCCGAGGGCGACTTCGATCTGTCGGAGATCGTGCTGAAGGCCAAGGCGCTGGCGGCCGACGCCGAGCAGC
GCGGCCTGGCGGCGCTCGCCAAGCTGCCGGCCCGGCCGGCGGCGGCGGTGGACGCGGCCAAGCTGCTGGCCGACGCGCTC
GAACGCGCGGCGCGGCCGGCCTACGACCTGCTCGCGCCGGAGCAGGCCGGGCGCGATCCGCAGGTCGCCAGCATGCTGGC
CAAGCTCGCCGCGCCGGCCGCCGACGCCGGCCCGAAGCAGCACGAGCGCCACCAGCACGCGCGCGACGCGGTCCTGAAGA
TTCCGGCGCTGCGGCGCCAGGCGCGCCGCTCGGCGCCGAAGCCGACGCTCGCCGCGCTGCCCTATCCGGCCGACGTCGCG
CGCCGCCTCGGCGAGCAGATCCGCCAATGGCACGCGGCGGGCGTGGTGCTGGCCGGGCGCGACCTGGCCGGCGCCGATCT
GGCCGGCCTCGATTTCTCGGGCGCCGACCTGCGCGAGGCGATGCTCGACGGCGCCGACCTCAGCGGGGCGAAATTCGTCG
GCGCCAAGCTGCAGGGCGCCGTGCTGGTGGGCGCGCGCCTGGACCACGCCGATTTTTCGGGCGCCGACCTCACGCGCGCC
AACCTCTGCATGAGCAGCGGCCGCGCCATCTCGTTCGACGGCGCCGAGCTGGGCCACGCCCAGGCGATCGACGCGCAGTG
GCCGCAGGCCAGCCTGCGCGGCGCCCGGCTGGGCCGCCTGCTCGGGCTGCGGCTCGCCTGCCCCGGCGCCGTGTTCGACG
AGGCCGACGCGAGCAAGGCAACGCTGTTCGACCTCGCGGCCGAGGACAGCCGCTGGCATGCCGCGCGGCTCGAGAAGACG
GTGTTCATGCGCGCGCGGCTGACGCGCGCCGGCTTCGCGGGCGCGCGGCTGACCAAGACCGTGTTCACCATGAGCGACCT
GCAGGCGAGCCGCTGGGAAGGCGCGCGGCTCGACGGCGTGCAGGGCGGCACCCGGAGCATCTGGCGCGACGCCGTGATGA
GCGGCGTGACGGCGCGCAACAGCGGCTTCGCCGGCGCCGACCTCTCGCACGCCGATCTGGAGGCGGCCAGCTTCCTGCGC
TGCGACTTCGGCCAGGCCGAGCTGCGCGGCGCCCGGCTGGTGGCCGGCCTGTTCTCGCACTGCGGCTTCTATGCGAGCCG
GCTGCGCATGGTCGAGGCAAGCGGCGCCGAGTTCTACCAATGCACCTGCCGCAAGACCGATTTCACCGGCGCGCGGCTGG
TGGACGCCGTGTTCGCGCAGTGCGAGCAGACCGGCGCGATCCCGCCGCAAGGCGTCACCACCGGGAGCCCCGCATGA