Detailed information of accessory protein


Summary

Accessory protein ID ACP00035 experimental
Type structure affiliated protein
Related T6SS (Type) T6SS00931 (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Related structure protein SciP
Related effector peptidoglycan
Description SciZ interacts with a SciNPS complex through direct interactions with SciP and the periplasmic domain of SciZ interacts with the PG
Reference [1] Aschtgen MS, Gavioli M, Dessen A, et al. The SciZ protein anchors the enteroaggregative Escherichia coli Type VI secretion system to the cell wall. Mol Microbiol. 2010 Feb;75(4):886-99. doi: 10.1111/j.1365-2958.2009.07028.x. PMID: 20487285
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) EC042_RS24190 (sciZ)
Coordinates (Strand) 4856944..4858674 (+)
NCBI ID 446480629
RefSeq NC_017626
Uniprot ID D3GUV9_ECO44
KEGG ID elo:EC042_4528
PDB ID 5M38, 5M3G

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
OmpA PF00691.22 2.4e-15 448..544

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MHVRSR
Transmembrane helix 7-29 LWLTILSLFLTLWLISGFLPLSA
Outside 30-32 VNQ
Transmembrane helix 33-51 IILTLVSVVAAGLVLWYQW
Inside 52-329 RCLSSRRDIPEKAGDDGLPPEYFQGHVLLVAGNSDAWFEPGQAYRETASGWYLRVDTPEQMRILAERLSYSRPALCGQVVVMLGLLPEQHTSDEAFLSWLRNWQRAVMQCRQWLNTTPPVLVTLMVSEPSPQNTSLNKHSTHWFTLTPDLPGMHIRLTEAGAIPAEEWLQACDAASRLRCVSELLWLNAMLSWYNRVTDALTAICRQEHFYFRPVAVGFCLTSVAARPGNLWQQQLTSLTALPPPAGVSSQVLPLPDILLSGIPRHRGLSHWHRLCRQ
Transmembrane helix 330-347 TGAIVGVFLLLAMLASFM
Outside 348-576 NNQRLVRSVGEHLTAWHRMRGYSSESKTTALQRLQADSQLLNDWQQRGVPQRYGLGLYQGMWLIPPVERATGEWVAPRPPRPVIQKVTQTPKTVRLNSLALFDAGKWTLKPGATKWLVNALVDIKAKAGWLIVVSGHTDNTGDPLRNQALSLKRAEAVRDWMRDTGDIPQSCFAVQGYGESRPVAPNDTAEGRARNRRVEISLVPQADACRLPDVSPAPEEGASENITE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9945 - -



  Protein sequence: 577 a.a.    

>ACP00035 NC_017626:4856944-4858674 [Escherichia coli 042]
MHVRSRLWLTILSLFLTLWLISGFLPLSAVNQIILTLVSVVAAGLVLWYQWRCLSSRRDIPEKAGDDGLPPEYFQGHVLL
VAGNSDAWFEPGQAYRETASGWYLRVDTPEQMRILAERLSYSRPALCGQVVVMLGLLPEQHTSDEAFLSWLRNWQRAVMQ
CRQWLNTTPPVLVTLMVSEPSPQNTSLNKHSTHWFTLTPDLPGMHIRLTEAGAIPAEEWLQACDAASRLRCVSELLWLNA
MLSWYNRVTDALTAICRQEHFYFRPVAVGFCLTSVAARPGNLWQQQLTSLTALPPPAGVSSQVLPLPDILLSGIPRHRGL
SHWHRLCRQTGAIVGVFLLLAMLASFMNNQRLVRSVGEHLTAWHRMRGYSSESKTTALQRLQADSQLLNDWQQRGVPQRY
GLGLYQGMWLIPPVERATGEWVAPRPPRPVIQKVTQTPKTVRLNSLALFDAGKWTLKPGATKWLVNALVDIKAKAGWLIV
VSGHTDNTGDPLRNQALSLKRAEAVRDWMRDTGDIPQSCFAVQGYGESRPVAPNDTAEGRARNRRVEISLVPQADACRLP
DVSPAPEEGASENITE*

  Nucleotide sequence: 1731 bp    

>ACP00035 NC_017626:4856944-4858674 [Escherichia coli 042]
ATGCACGTACGTTCCCGTCTCTGGCTGACAATACTGAGTCTGTTCCTGACACTGTGGCTGATTTCGGGATTCCTGCCGCT
GTCTGCAGTAAACCAGATAATACTGACCCTGGTTTCAGTTGTGGCGGCGGGGCTTGTGCTGTGGTACCAGTGGCGTTGTC
TGTCTTCCCGTCGTGATATCCCGGAGAAGGCCGGCGATGACGGTCTGCCGCCTGAGTATTTTCAGGGACATGTGCTGCTT
GTTGCCGGAAACTCAGATGCGTGGTTCGAACCCGGTCAGGCATACCGGGAAACAGCATCGGGATGGTATCTTCGTGTGGA
TACGCCGGAGCAGATGAGAATACTGGCAGAACGGTTGTCGTACAGCCGTCCGGCCCTGTGTGGCCAGGTCGTGGTCATGC
TGGGACTTTTACCGGAGCAGCATACCTCAGATGAAGCTTTCCTGTCGTGGTTGCGGAACTGGCAGCGTGCAGTCATGCAG
TGCCGGCAGTGGCTGAATACCACGCCACCGGTGCTGGTTACATTGATGGTTTCAGAGCCGTCACCACAAAACACATCCTT
AAATAAGCACTCTACACACTGGTTTACACTGACACCGGACCTGCCGGGAATGCATATACGCCTGACGGAAGCCGGAGCAA
TTCCGGCAGAGGAATGGCTGCAGGCGTGTGATGCAGCGTCCAGGCTCCGGTGCGTCAGTGAACTGTTATGGCTGAATGCC
ATGTTGTCCTGGTACAACCGGGTTACTGATGCCCTGACAGCTATTTGCCGGCAGGAGCACTTTTATTTCCGGCCGGTTGC
CGTTGGATTCTGTCTGACGTCGGTTGCGGCCCGCCCCGGTAATCTCTGGCAACAACAACTGACGTCCCTCACTGCATTGC
CACCGCCTGCCGGCGTGTCATCACAGGTATTGCCGTTGCCGGATATTCTGCTGTCCGGTATTCCCCGTCATCGTGGACTC
AGTCACTGGCACAGACTTTGTCGCCAGACGGGGGCGATTGTCGGTGTTTTTCTTCTGCTGGCTATGCTGGCGTCTTTTAT
GAATAACCAGCGGCTGGTTCGCAGCGTGGGGGAACACCTGACGGCCTGGCACCGGATGCGCGGATATTCATCTGAATCGA
AAACAACAGCACTGCAACGTCTTCAGGCTGACAGCCAGTTACTGAACGACTGGCAGCAACGTGGTGTGCCACAGCGTTAC
GGACTGGGATTGTATCAGGGAATGTGGCTGATACCGCCGGTTGAGCGTGCGACTGGTGAGTGGGTTGCACCACGGCCTCC
CCGTCCGGTGATACAGAAAGTTACTCAGACGCCGAAAACGGTTCGCCTTAACAGCCTGGCACTGTTTGATGCCGGTAAAT
GGACGCTGAAGCCGGGCGCCACAAAATGGCTGGTGAATGCCCTGGTGGATATTAAGGCAAAAGCAGGCTGGCTGATTGTG
GTCAGTGGTCACACGGATAATACCGGTGACCCGCTGCGCAACCAGGCCTTGTCCCTGAAGCGTGCAGAGGCCGTTCGCGA
CTGGATGCGGGATACCGGCGATATTCCCCAAAGCTGTTTTGCCGTACAGGGATACGGTGAAAGCCGCCCTGTGGCCCCGA
ATGACACGGCGGAAGGCCGTGCGCGTAACCGCCGTGTTGAAATCAGTCTGGTACCGCAGGCCGATGCCTGTCGTCTGCCG
GACGTTTCCCCTGCGCCGGAAGAGGGCGCATCAGAAAACATAACGGAGTAA