Detailed information of accessory protein


Summary

Accessory protein ID ACP00026 experimental
Type adaptor
Related T6SS (Type) T6SS00790 (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Related structure protein -
Related effector VasX
Description The genome of V. cholerae encodes DUF4123 domain protein, VasW,which is known to be required for secretion of its downstream effector, VasX.
Reference [1] Miyata ST, Unterweger D, Rudko SP, et al. Dual expression profile of type VI secretion system immunity genes protects pandemic Vibrio cholerae. PLoS Pathog. 2013;9(12):e1003752. doi: 10.1371/journal.ppat.1003752. Epub 2013 Dec 5. PMID: 24348240
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_RS01475 (vasW)
Coordinates (Strand) 319289..320176 (-)
NCBI ID 447180717
RefSeq NZ_KQ410497
Uniprot ID VASW_VIBCH, A0A023PTD7_VIBCL, A0A0H3AEJ8_VIBC3, A0A0H3Q6C7_VIBCL, A0A0K9UWM8_VIBCL, A0A0X1L1I8_VIBCO, C3LU48_VIBCM
KEGG ID vcm:VCM66_A0018, vco:VC0395_0114, vcq:EN18_03865, vch:VCA0019
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4123 PF13503.8 1.9e-17 27..136

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-295 MRSTNSFVVHNWVSLVPEMEMDTQERLYLLVDGAQISHLAQALYRLSGELVLEPLYLFPPFEQLKEVSPYLVLATDTVKTWFLEQNQGLAGFFFASLDSIEEIAEQLRRLIQVESPYGSTVFLKMANSECAYVLLSTQCQPLWKVINRAWLPTRQGWQYVQRPELTATQDTPVRFKLTDEQWQRLGNITWLNTLETVERHVQQWFPDLAQQWQSDPELFHRHAQWAYQQGFSSERDLMLFFNVLGFLGVDALEKGKYPEIDPLLHQASSRTPSQRIEAAAELAYQHSQSSQEVQG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9912 - -



  Protein sequence: 296 a.a.    

>ACP00026 NZ_KQ410497:c320176-319289 [Vibrio cholerae V52]
MRSTNSFVVHNWVSLVPEMEMDTQERLYLLVDGAQISHLAQALYRLSGELVLEPLYLFPPFEQLKEVSPYLVLATDTVKT
WFLEQNQGLAGFFFASLDSIEEIAEQLRRLIQVESPYGSTVFLKMANSECAYVLLSTQCQPLWKVINRAWLPTRQGWQYV
QRPELTATQDTPVRFKLTDEQWQRLGNITWLNTLETVERHVQQWFPDLAQQWQSDPELFHRHAQWAYQQGFSSERDLMLF
FNVLGFLGVDALEKGKYPEIDPLLHQASSRTPSQRIEAAAELAYQHSQSSQEVQG*

  Nucleotide sequence: 888 bp    

>ACP00026 NZ_KQ410497:c320176-319289 [Vibrio cholerae V52]
ATGCGTTCAACAAATTCCTTTGTCGTGCATAACTGGGTGAGCTTGGTTCCAGAGATGGAAATGGATACACAAGAAAGGCT
TTACCTTTTGGTTGATGGTGCTCAAATCAGCCATCTAGCACAAGCCTTGTATCGTCTATCGGGTGAATTGGTTTTGGAGC
CTTTGTACCTTTTTCCGCCTTTTGAGCAGCTTAAAGAGGTGTCTCCTTATCTCGTGTTAGCAACGGATACGGTTAAAACC
TGGTTCCTTGAGCAGAATCAGGGGTTAGCTGGGTTCTTTTTTGCTTCTTTAGATTCTATTGAAGAGATTGCTGAACAACT
GCGTCGTTTGATCCAAGTGGAGTCCCCTTATGGTTCAACGGTGTTTCTTAAAATGGCGAACAGTGAATGCGCGTATGTAC
TTTTGAGTACCCAATGCCAACCGCTGTGGAAAGTGATCAATCGAGCTTGGTTGCCGACACGTCAAGGTTGGCAATATGTG
CAACGACCCGAACTGACGGCGACTCAAGACACTCCTGTGCGATTCAAGTTAACCGATGAGCAGTGGCAACGGCTTGGCAA
CATCACATGGCTTAATACCTTAGAAACGGTCGAGCGGCATGTGCAGCAGTGGTTCCCGGATTTAGCGCAGCAGTGGCAGT
CTGACCCTGAACTATTTCATCGTCATGCTCAATGGGCTTACCAGCAGGGCTTTAGCAGTGAGCGAGATTTAATGCTGTTT
TTTAATGTGTTGGGGTTTTTAGGTGTTGATGCTCTTGAAAAAGGGAAGTATCCCGAGATTGATCCTTTGTTGCATCAGGC
TTCAAGTCGTACGCCTTCGCAACGCATTGAAGCTGCCGCAGAGCTGGCTTATCAACATTCACAATCATCACAGGAGGTAC
AAGGATGA