Detailed information of accessory protein


Summary

Accessory protein ID ACP00025 experimental
Type adaptor
Related T6SS (Type) T6SS00790 (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Related structure protein VgrG-1
Related effector TseL
Description Tap-1, DUF4123 domain-containing protein.
Reference [1] Unterweger D, Kostiuk B, Ă–tjengerdes R, et al. Chimeric adaptor proteins translocate diverse type VI secretion system effectors in Vibrio cholerae. EMBO J. 2015 Aug 13;34(16):2198-210. doi: 10.15252/embj.201591163. Epub 2015 Jul 19. PMID: 26194724
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VCV52_1391 (tap-1)
Coordinates (Strand) 434220..435080 (-)
NCBI ID 446336115
RefSeq NZ_KQ410498
Uniprot ID UPI00005F3639
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4123 PF13503.8 8.3e-16 28..140

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-286 MATHYCLVENGMEKMLLQWLSEQTSNVYWLADHLTFKQAVANNSGIVFDGTQVVFHGETFAPVMALSPWLVPVSDMVSDIDYECLQQGIFLSCSCPSTELLSHLQSLLIAALEGEEVLFRFYDRQVIVPMLERMDEIEKNQFLGKINQLVVFDSHEKNRLVSFTNTSDAQFTAKKTTWWVIKRHHLEAHENLPLVQANLESWLWRHFPKVMNEYLIQGRDIASMLAPSLSVPEQTLTYRVLSAAIVAVVGAEQLTQPSMIEFLRDYNNEEAQLALHALTRQFELRG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9975 - -



  Protein sequence: 287 a.a.    

>ACP00025 NZ_KQ410498:c435080-434220 [Vibrio cholerae V52]
MATHYCLVENGMEKMLLQWLSEQTSNVYWLADHLTFKQAVANNSGIVFDGTQVVFHGETFAPVMALSPWLVPVSDMVSDI
DYECLQQGIFLSCSCPSTELLSHLQSLLIAALEGEEVLFRFYDRQVIVPMLERMDEIEKNQFLGKINQLVVFDSHEKNRL
VSFTNTSDAQFTAKKTTWWVIKRHHLEAHENLPLVQANLESWLWRHFPKVMNEYLIQGRDIASMLAPSLSVPEQTLTYRV
LSAAIVAVVGAEQLTQPSMIEFLRDYNNEEAQLALHALTRQFELRG*

  Nucleotide sequence: 861 bp    

>ACP00025 NZ_KQ410498:c435080-434220 [Vibrio cholerae V52]
ATGGCAACGCATTATTGCTTAGTGGAAAATGGAATGGAAAAGATGCTTTTACAATGGTTGAGTGAACAGACATCAAACGT
CTATTGGCTTGCTGATCATTTAACGTTTAAACAGGCGGTGGCGAATAACAGTGGAATTGTATTTGATGGTACACAAGTTG
TTTTCCACGGAGAGACCTTTGCCCCTGTGATGGCGTTATCGCCCTGGTTAGTCCCTGTCTCTGATATGGTATCGGATATC
GACTACGAGTGCTTACAACAAGGTATATTCCTAAGTTGCTCCTGTCCCTCCACAGAGTTATTAAGCCATCTCCAAAGCCT
TTTGATTGCAGCACTGGAAGGCGAAGAAGTACTGTTTCGTTTTTATGATAGGCAGGTCATTGTGCCTATGCTTGAACGAA
TGGATGAAATAGAAAAAAATCAGTTCTTAGGTAAGATAAATCAGTTAGTCGTGTTCGATAGCCATGAGAAAAATCGGTTA
GTCTCATTTACCAATACATCAGACGCTCAGTTTACGGCCAAAAAGACAACGTGGTGGGTGATCAAACGACACCATTTGGA
GGCTCATGAGAATTTGCCTCTTGTTCAAGCTAACCTCGAATCTTGGCTATGGCGGCATTTTCCAAAAGTGATGAACGAGT
ACTTAATTCAAGGGCGTGATATCGCTTCCATGCTCGCTCCATCTCTCTCTGTTCCTGAACAAACCTTAACATATCGTGTG
TTAAGTGCCGCTATCGTTGCTGTTGTCGGTGCCGAACAATTGACTCAGCCTAGCATGATTGAATTTCTACGAGACTATAA
CAACGAAGAAGCTCAGCTCGCTCTGCATGCTTTAACTCGTCAATTTGAACTAAGGGGATAA