Detailed information of accessory protein


Summary

Accessory protein ID ACP00012 experimental
Type adaptor
Related T6SS (Type) T6SS00035 (Type i3)
Strain Pseudomonas protegens Pf-5
Replicon chromosome
Related structure protein -
Related effector PFL_6096 (RhsA)
Description EagR1 stabilizes the N-terminus of RhsA, which may also orient the effector such that it can interact with its cognate VgrG
Reference [1] Ahmad S, Tsang KK, Sachar K, et al. Structural basis for effector transmembrane domain recognition by type VI secretion system chaperones. Elife. 2020 Dec 15;9. pii: e62816. doi: 10.7554/eLife.62816. PMID: 33320089
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PFL_6095 (eagR1)
Coordinates (Strand) 6924978..6925403 (+)
NCBI ID 499376685
RefSeq NC_004129
Uniprot ID A0A1K2A9S4_9PSED, A0A2C9EVT3_PSEPH, A0A2T0Z7R4_9PSED, Q4K3N0_PSEF5
KEGG ID pprc:PFLCHA0_c60540, pfl:PFL_6095
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DcrB PF08786.13 8.8e-28 7..137

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-141 MTYRLNELQFQLPAGELQDASINILKFPALGTSLIVSRSLLGDGETLESNLASQLQRLEQQVQDLRCQAPQPVQLGPAQDIQGLELRSQFNKGKEQVFQFQLALVLPGTRQMLAMSYVKAQKLGDAEAAHWAQIKNTLVLG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9541 - -



  Protein sequence: 142 a.a.    

>ACP00012 NC_004129:6924978-6925403 [Pseudomonas protegens Pf-5]
MTYRLNELQFQLPAGELQDASINILKFPALGTSLIVSRSLLGDGETLESNLASQLQRLEQQVQDLRCQAPQPVQLGPAQD
IQGLELRSQFNKGKEQVFQFQLALVLPGTRQMLAMSYVKAQKLGDAEAAHWAQIKNTLVLG*

  Nucleotide sequence: 426 bp    

>ACP00012 NC_004129:6924978-6925403 [Pseudomonas protegens Pf-5]
ATGACCTATCGCCTCAATGAATTGCAGTTCCAACTGCCTGCCGGCGAACTGCAGGACGCCTCGATCAACATCCTCAAGTT
CCCGGCCTTGGGCACTTCGCTGATCGTCAGCCGCAGCCTGCTGGGGGACGGCGAAACCCTGGAGAGCAACCTGGCCAGCC
AGCTGCAGCGGCTGGAGCAGCAAGTCCAGGACCTGCGCTGCCAGGCTCCGCAACCGGTGCAGCTGGGCCCGGCCCAGGAC
ATCCAGGGCCTGGAGCTGCGCAGCCAGTTCAACAAGGGCAAAGAACAGGTGTTCCAGTTCCAGCTGGCCCTGGTGCTGCC
CGGCACCCGACAGATGCTCGCCATGAGCTACGTCAAGGCACAGAAGCTCGGCGACGCGGAAGCCGCCCATTGGGCGCAGA
TCAAGAACACCCTGGTGCTGGGCTGA