Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD409_RS07610 | Genome accession | NZ_CP155741 |
| Coordinates | 1508579..1508758 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 400/03 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1508579..1549196 | 1508579..1508758 | within | 0 |
Gene organization within MGE regions
Location: 1508579..1549196
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD409_RS07610 (ABD409_07585) | prx | 1508579..1508758 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD409_RS07615 (ABD409_07590) | sda1 | 1508997..1510169 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD409_RS07620 (ABD409_07595) | - | 1510285..1511481 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD409_RS07625 (ABD409_07600) | - | 1511592..1511777 (-) | 186 | WP_021341107.1 | holin | - |
| ABD409_RS07630 (ABD409_07605) | - | 1511774..1512073 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD409_RS07635 (ABD409_07610) | - | 1512084..1512704 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD409_RS07640 (ABD409_07615) | - | 1512707..1512868 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD409_RS07645 (ABD409_07620) | - | 1512877..1514784 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD409_RS07650 (ABD409_07625) | - | 1514795..1515430 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD409_RS07655 (ABD409_07630) | - | 1515430..1516485 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD409_RS07660 (ABD409_07635) | - | 1516482..1518464 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD409_RS07665 (ABD409_07640) | - | 1518474..1519316 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD409_RS07670 (ABD409_07645) | - | 1519328..1523710 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD409_RS07675 (ABD409_07650) | - | 1523725..1523958 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD409_RS07680 (ABD409_07655) | - | 1524033..1524488 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD409_RS07685 (ABD409_07660) | - | 1524542..1525141 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD409_RS07690 (ABD409_07665) | - | 1525153..1525512 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD409_RS07695 (ABD409_07670) | - | 1525516..1525860 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD409_RS07700 (ABD409_07675) | - | 1525857..1526135 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD409_RS07705 (ABD409_07680) | - | 1526146..1526502 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD409_RS07710 (ABD409_07685) | - | 1526514..1527401 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD409_RS07715 (ABD409_07690) | - | 1527414..1527983 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD409_RS07720 (ABD409_07695) | - | 1528139..1528405 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD409_RS07725 (ABD409_07700) | - | 1528408..1528596 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD409_RS07730 (ABD409_07705) | - | 1528627..1530072 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD409_RS07735 (ABD409_07710) | - | 1530032..1531564 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD409_RS07740 (ABD409_07715) | - | 1531580..1532857 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD409_RS07745 (ABD409_07720) | - | 1532847..1533299 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD409_RS07750 (ABD409_07725) | - | 1533389..1533805 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD409_RS07755 (ABD409_07730) | - | 1533802..1533993 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD409_RS07760 (ABD409_07735) | - | 1533983..1534771 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD409_RS07765 (ABD409_07740) | - | 1534843..1535109 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD409_RS07770 (ABD409_07745) | - | 1535106..1535273 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD409_RS07775 (ABD409_07750) | - | 1535274..1536596 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD409_RS07780 (ABD409_07755) | - | 1536593..1536868 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD409_RS07785 (ABD409_07760) | - | 1537255..1539639 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD409_RS07790 (ABD409_07765) | - | 1539644..1541566 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD409_RS07795 (ABD409_07770) | - | 1541609..1542166 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD409_RS07800 (ABD409_07775) | - | 1542177..1542575 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD409_RS07805 (ABD409_07780) | - | 1542579..1543733 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD409_RS07810 (ABD409_07785) | - | 1543733..1544032 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD409_RS07815 (ABD409_07790) | - | 1544120..1544323 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD409_RS07820 (ABD409_07795) | - | 1544470..1544856 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD409_RS07825 (ABD409_07800) | - | 1544853..1545056 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD409_RS07830 (ABD409_07805) | - | 1545049..1545219 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD409_RS07835 (ABD409_07810) | - | 1545216..1545491 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD409_RS07840 (ABD409_07815) | - | 1545553..1545768 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD409_RS07845 (ABD409_07820) | - | 1545816..1546229 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD409_RS07850 (ABD409_07825) | - | 1546210..1546365 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD409_RS07855 (ABD409_07830) | - | 1546691..1547041 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ABD409_RS07860 (ABD409_07835) | - | 1547055..1547438 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD409_RS07865 (ABD409_07840) | - | 1547449..1548000 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD409_RS07870 (ABD409_07845) | - | 1548117..1549196 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=999273 ABD409_RS07610 WP_002988813.1 1508579..1508758(-) (prx) [Streptococcus pyogenes strain 400/03]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=999273 ABD409_RS07610 WP_002988813.1 1508579..1508758(-) (prx) [Streptococcus pyogenes strain 400/03]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |