Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD409_RS03250 | Genome accession | NZ_CP155741 |
| Coordinates | 606592..606771 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 400/03 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 561335..610139 | 606592..606771 | within | 0 |
Gene organization within MGE regions
Location: 561335..610139
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD409_RS02935 (ABD409_02920) | - | 561335..561784 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| ABD409_RS02940 (ABD409_02925) | - | 561959..562243 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| ABD409_RS02945 (ABD409_02930) | - | 562236..563498 (+) | 1263 | WP_023612361.1 | chloride channel protein | - |
| ABD409_RS02950 (ABD409_02935) | rplS | 563613..563960 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| ABD409_RS02960 (ABD409_02945) | - | 564323..565399 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| ABD409_RS02965 (ABD409_02950) | - | 565518..566039 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| ABD409_RS02970 (ABD409_02955) | - | 566050..566427 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD409_RS02975 (ABD409_02960) | - | 566411..566770 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| ABD409_RS02980 (ABD409_02965) | - | 566958..567176 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| ABD409_RS02985 (ABD409_02970) | - | 567276..567506 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| ABD409_RS02990 (ABD409_02975) | - | 567643..567861 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| ABD409_RS02995 (ABD409_02980) | - | 567863..568105 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| ABD409_RS03000 (ABD409_02985) | - | 568089..569408 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| ABD409_RS03005 (ABD409_02990) | - | 569423..570505 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| ABD409_RS03010 (ABD409_02995) | - | 570544..570678 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| ABD409_RS03015 (ABD409_03000) | - | 570700..571293 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| ABD409_RS03020 (ABD409_03005) | - | 571293..572876 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| ABD409_RS03025 (ABD409_03010) | - | 572889..573083 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| ABD409_RS03030 (ABD409_03015) | - | 573106..575349 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| ABD409_RS03035 (ABD409_03020) | - | 575641..575823 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| ABD409_RS03040 (ABD409_03025) | - | 575816..576211 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABD409_RS03045 (ABD409_03030) | - | 576208..576432 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| ABD409_RS03050 (ABD409_03035) | - | 576435..576620 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| ABD409_RS03055 (ABD409_03040) | - | 576617..576868 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| ABD409_RS03060 (ABD409_03045) | - | 576852..577256 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| ABD409_RS03065 (ABD409_03050) | - | 577253..577537 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| ABD409_RS03070 (ABD409_03055) | - | 577539..578171 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ABD409_RS03075 (ABD409_03060) | - | 578174..578884 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| ABD409_RS03080 (ABD409_03065) | - | 578881..579252 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| ABD409_RS03085 (ABD409_03070) | - | 579520..579957 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ABD409_RS03090 (ABD409_03075) | - | 580476..580721 (-) | 246 | WP_153279561.1 | hypothetical protein | - |
| ABD409_RS03095 (ABD409_03080) | - | 580814..581332 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ABD409_RS03100 (ABD409_03085) | - | 581311..581988 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ABD409_RS03105 (ABD409_03090) | - | 581997..582380 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABD409_RS03110 (ABD409_03095) | - | 582441..582818 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABD409_RS03115 (ABD409_03100) | - | 582860..583342 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| ABD409_RS03120 (ABD409_03105) | - | 583425..584636 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ABD409_RS03125 (ABD409_03110) | - | 584650..586152 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ABD409_RS03130 (ABD409_03115) | - | 586157..587635 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ABD409_RS03135 (ABD409_03120) | - | 587607..587846 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABD409_RS03140 (ABD409_03125) | - | 587908..588174 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ABD409_RS03145 (ABD409_03130) | - | 588300..588914 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ABD409_RS03150 (ABD409_03135) | - | 588918..589736 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABD409_RS03155 (ABD409_03140) | - | 589790..590206 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ABD409_RS03160 (ABD409_03145) | - | 590196..590528 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABD409_RS03165 (ABD409_03150) | - | 590528..590884 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABD409_RS03170 (ABD409_03155) | - | 590881..591279 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABD409_RS03175 (ABD409_03160) | - | 591279..591764 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ABD409_RS03180 (ABD409_03165) | - | 591803..592237 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ABD409_RS03185 (ABD409_03170) | - | 592241..592822 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| ABD409_RS03190 (ABD409_03175) | - | 592812..596072 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| ABD409_RS03195 (ABD409_03180) | - | 596069..596785 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ABD409_RS03200 (ABD409_03185) | - | 596782..598929 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| ABD409_RS03205 (ABD409_03190) | - | 598926..600140 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ABD409_RS03210 (ABD409_03195) | - | 600142..600456 (+) | 315 | WP_242493588.1 | hypothetical protein | - |
| ABD409_RS03215 (ABD409_03200) | - | 600467..602356 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| ABD409_RS03220 (ABD409_03205) | - | 602368..602796 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ABD409_RS03225 (ABD409_03210) | - | 602799..603431 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ABD409_RS03230 (ABD409_03215) | - | 603443..603715 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ABD409_RS03235 (ABD409_03220) | - | 603712..603939 (+) | 228 | WP_011054444.1 | phage holin | - |
| ABD409_RS03240 (ABD409_03225) | - | 604055..605263 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| ABD409_RS03245 (ABD409_03230) | - | 605373..606359 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| ABD409_RS03250 (ABD409_03235) | prx | 606592..606771 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
| ABD409_RS03255 (ABD409_03240) | - | 606952..607272 (-) | 321 | Protein_592 | site-specific integrase | - |
| ABD409_RS03260 (ABD409_03245) | - | 607626..608186 (+) | 561 | WP_023612339.1 | HAD-IA family hydrolase | - |
| ABD409_RS03265 (ABD409_03250) | gyrB | 608187..610139 (+) | 1953 | WP_038431254.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=999256 ABD409_RS03250 WP_030127450.1 606592..606771(+) (prx) [Streptococcus pyogenes strain 400/03]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=999256 ABD409_RS03250 WP_030127450.1 606592..606771(+) (prx) [Streptococcus pyogenes strain 400/03]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |