Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD410_RS07265 | Genome accession | NZ_CP155740 |
| Coordinates | 1460249..1460428 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 1851/03 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1460249..1500866 | 1460249..1460428 | within | 0 |
Gene organization within MGE regions
Location: 1460249..1500866
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD410_RS07265 (ABD410_07235) | prx | 1460249..1460428 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD410_RS07270 (ABD410_07240) | sda1 | 1460667..1461839 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD410_RS07275 (ABD410_07245) | - | 1461955..1463151 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD410_RS07280 (ABD410_07250) | - | 1463262..1463447 (-) | 186 | WP_002988802.1 | holin | - |
| ABD410_RS07285 (ABD410_07255) | - | 1463444..1463743 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD410_RS07290 (ABD410_07260) | - | 1463754..1464374 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD410_RS07295 (ABD410_07265) | - | 1464377..1464538 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD410_RS07300 (ABD410_07270) | - | 1464547..1466454 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD410_RS07305 (ABD410_07275) | - | 1466465..1467100 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD410_RS07310 (ABD410_07280) | - | 1467100..1468155 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD410_RS07315 (ABD410_07285) | - | 1468152..1470134 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD410_RS07320 (ABD410_07290) | - | 1470144..1470986 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD410_RS07325 (ABD410_07295) | - | 1470998..1475380 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD410_RS07330 (ABD410_07300) | - | 1475395..1475628 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD410_RS07335 (ABD410_07305) | - | 1475703..1476158 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD410_RS07340 (ABD410_07310) | - | 1476212..1476811 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD410_RS07345 (ABD410_07315) | - | 1476823..1477182 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD410_RS07350 (ABD410_07320) | - | 1477186..1477530 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD410_RS07355 (ABD410_07325) | - | 1477527..1477805 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD410_RS07360 (ABD410_07330) | - | 1477816..1478172 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD410_RS07365 (ABD410_07335) | - | 1478184..1479071 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD410_RS07370 (ABD410_07340) | - | 1479084..1479653 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD410_RS07375 (ABD410_07345) | - | 1479809..1480075 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD410_RS07380 (ABD410_07350) | - | 1480078..1480266 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD410_RS07385 (ABD410_07355) | - | 1480297..1481742 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD410_RS07390 (ABD410_07360) | - | 1481702..1483234 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD410_RS07395 (ABD410_07365) | - | 1483250..1484527 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD410_RS07400 (ABD410_07370) | - | 1484517..1484969 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD410_RS07405 (ABD410_07375) | - | 1485059..1485475 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD410_RS07410 (ABD410_07380) | - | 1485472..1485663 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD410_RS07415 (ABD410_07385) | - | 1485653..1486504 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ABD410_RS07420 (ABD410_07390) | - | 1486513..1486779 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD410_RS07425 (ABD410_07395) | - | 1486776..1486943 (-) | 168 | WP_165354939.1 | hypothetical protein | - |
| ABD410_RS07430 (ABD410_07400) | - | 1486944..1488266 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD410_RS07435 (ABD410_07405) | - | 1488263..1488538 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD410_RS07440 (ABD410_07410) | - | 1488925..1491309 (-) | 2385 | WP_129795404.1 | phage/plasmid primase, P4 family | - |
| ABD410_RS07445 (ABD410_07415) | - | 1491314..1493236 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD410_RS07450 (ABD410_07420) | - | 1493279..1493836 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD410_RS07455 (ABD410_07425) | - | 1493847..1494245 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD410_RS07460 (ABD410_07430) | - | 1494249..1495403 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD410_RS07465 (ABD410_07435) | - | 1495403..1495702 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD410_RS07470 (ABD410_07440) | - | 1495790..1495993 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD410_RS07475 (ABD410_07445) | - | 1496140..1496526 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD410_RS07480 (ABD410_07450) | - | 1496523..1496726 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD410_RS07485 (ABD410_07455) | - | 1496719..1496889 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD410_RS07490 (ABD410_07460) | - | 1496886..1497161 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD410_RS07495 (ABD410_07465) | - | 1497223..1497438 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD410_RS07500 (ABD410_07470) | - | 1497486..1497899 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD410_RS07505 (ABD410_07475) | - | 1497880..1498035 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD410_RS07510 (ABD410_07480) | - | 1498361..1498711 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ABD410_RS07515 (ABD410_07485) | - | 1498725..1499108 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD410_RS07520 (ABD410_07490) | - | 1499119..1499670 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD410_RS07525 (ABD410_07495) | - | 1499787..1500866 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=999214 ABD410_RS07265 WP_002988813.1 1460249..1460428(-) (prx) [Streptococcus pyogenes strain 1851/03]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=999214 ABD410_RS07265 WP_002988813.1 1460249..1460428(-) (prx) [Streptococcus pyogenes strain 1851/03]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |