Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD426_RS07760 | Genome accession | NZ_CP155739 |
| Coordinates | 1539107..1539286 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 997/08 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1539107..1579724 | 1539107..1539286 | within | 0 |
Gene organization within MGE regions
Location: 1539107..1579724
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD426_RS07760 (ABD426_07730) | prx | 1539107..1539286 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD426_RS07765 (ABD426_07735) | sda1 | 1539525..1540697 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD426_RS07770 (ABD426_07740) | - | 1540813..1542009 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD426_RS07775 (ABD426_07745) | - | 1542120..1542305 (-) | 186 | WP_021341107.1 | holin | - |
| ABD426_RS07780 (ABD426_07750) | - | 1542302..1542601 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD426_RS07785 (ABD426_07755) | - | 1542612..1543232 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD426_RS07790 (ABD426_07760) | - | 1543235..1543396 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD426_RS07795 (ABD426_07765) | - | 1543405..1545312 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD426_RS07800 (ABD426_07770) | - | 1545323..1545958 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD426_RS07805 (ABD426_07775) | - | 1545958..1547013 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD426_RS07810 (ABD426_07780) | - | 1547010..1548992 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD426_RS07815 (ABD426_07785) | - | 1549002..1549844 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD426_RS07820 (ABD426_07790) | - | 1549856..1554238 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD426_RS07825 (ABD426_07795) | - | 1554253..1554486 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD426_RS07830 (ABD426_07800) | - | 1554561..1555016 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD426_RS07835 (ABD426_07805) | - | 1555070..1555669 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD426_RS07840 (ABD426_07810) | - | 1555681..1556040 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD426_RS07845 (ABD426_07815) | - | 1556044..1556388 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD426_RS07850 (ABD426_07820) | - | 1556385..1556663 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD426_RS07855 (ABD426_07825) | - | 1556674..1557030 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD426_RS07860 (ABD426_07830) | - | 1557042..1557929 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD426_RS07865 (ABD426_07835) | - | 1557942..1558511 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD426_RS07870 (ABD426_07840) | - | 1558667..1558933 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD426_RS07875 (ABD426_07845) | - | 1558936..1559124 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD426_RS07880 (ABD426_07850) | - | 1559155..1560600 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD426_RS07885 (ABD426_07855) | - | 1560560..1562092 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD426_RS07890 (ABD426_07860) | - | 1562108..1563385 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD426_RS07895 (ABD426_07865) | - | 1563375..1563827 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD426_RS07900 (ABD426_07870) | - | 1563917..1564333 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD426_RS07905 (ABD426_07875) | - | 1564330..1564521 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD426_RS07910 (ABD426_07880) | - | 1564511..1565299 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD426_RS07915 (ABD426_07885) | - | 1565371..1565637 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD426_RS07920 (ABD426_07890) | - | 1565634..1565801 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD426_RS07925 (ABD426_07895) | - | 1565802..1567124 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD426_RS07930 (ABD426_07900) | - | 1567121..1567396 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD426_RS07935 (ABD426_07905) | - | 1567783..1570167 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD426_RS07940 (ABD426_07910) | - | 1570172..1572094 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD426_RS07945 (ABD426_07915) | - | 1572137..1572694 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD426_RS07950 (ABD426_07920) | - | 1572705..1573103 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD426_RS07955 (ABD426_07925) | - | 1573107..1574261 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD426_RS07960 (ABD426_07930) | - | 1574261..1574560 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD426_RS07965 (ABD426_07935) | - | 1574648..1574851 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD426_RS07970 (ABD426_07940) | - | 1574998..1575384 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD426_RS07975 (ABD426_07945) | - | 1575381..1575584 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD426_RS07980 (ABD426_07950) | - | 1575577..1575747 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD426_RS07985 (ABD426_07955) | - | 1575744..1576019 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD426_RS07990 (ABD426_07960) | - | 1576081..1576296 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD426_RS07995 (ABD426_07965) | - | 1576344..1576757 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD426_RS08000 (ABD426_07970) | - | 1576738..1576893 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD426_RS08005 (ABD426_07975) | - | 1577168..1577569 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| ABD426_RS08010 (ABD426_07980) | - | 1577583..1577966 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD426_RS08015 (ABD426_07985) | - | 1577977..1578528 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD426_RS08020 (ABD426_07990) | - | 1578645..1579724 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=999157 ABD426_RS07760 WP_002988813.1 1539107..1539286(-) (prx) [Streptococcus pyogenes strain 997/08]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=999157 ABD426_RS07760 WP_002988813.1 1539107..1539286(-) (prx) [Streptococcus pyogenes strain 997/08]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |