Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD426_RS03200 | Genome accession | NZ_CP155739 |
| Coordinates | 594261..594440 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 997/08 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 547669..594502 | 594261..594440 | within | 0 |
Gene organization within MGE regions
Location: 547669..594502
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD426_RS02880 (ABD426_02865) | - | 547669..548610 (-) | 942 | WP_002985305.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| ABD426_RS02885 (ABD426_02870) | - | 549004..549453 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| ABD426_RS02890 (ABD426_02875) | - | 549628..549912 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| ABD426_RS02895 (ABD426_02880) | - | 549905..551167 (+) | 1263 | WP_050336105.1 | chloride channel protein | - |
| ABD426_RS02900 (ABD426_02885) | rplS | 551282..551629 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| ABD426_RS02910 (ABD426_02895) | - | 551992..553068 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| ABD426_RS02915 (ABD426_02900) | - | 553187..553708 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| ABD426_RS02920 (ABD426_02905) | - | 553719..554096 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD426_RS02925 (ABD426_02910) | - | 554080..554439 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| ABD426_RS02930 (ABD426_02915) | - | 554627..554845 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| ABD426_RS02935 (ABD426_02920) | - | 554945..555175 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| ABD426_RS02940 (ABD426_02925) | - | 555312..555530 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| ABD426_RS02945 (ABD426_02930) | - | 555532..555774 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| ABD426_RS02950 (ABD426_02935) | - | 555758..557077 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| ABD426_RS02955 (ABD426_02940) | - | 557092..558174 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| ABD426_RS02960 (ABD426_02945) | - | 558213..558347 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| ABD426_RS02965 (ABD426_02950) | - | 558369..558962 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| ABD426_RS02970 (ABD426_02955) | - | 558962..560545 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| ABD426_RS02975 (ABD426_02960) | - | 560558..560752 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| ABD426_RS02980 (ABD426_02965) | - | 560775..563018 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| ABD426_RS02985 (ABD426_02970) | - | 563310..563492 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| ABD426_RS02990 (ABD426_02975) | - | 563485..563880 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABD426_RS02995 (ABD426_02980) | - | 563877..564101 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| ABD426_RS03000 (ABD426_02985) | - | 564104..564289 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| ABD426_RS03005 (ABD426_02990) | - | 564286..564537 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| ABD426_RS03010 (ABD426_02995) | - | 564521..564925 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| ABD426_RS03015 (ABD426_03000) | - | 564922..565206 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| ABD426_RS03020 (ABD426_03005) | - | 565208..565840 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ABD426_RS03025 (ABD426_03010) | - | 565843..566553 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| ABD426_RS03030 (ABD426_03015) | - | 566550..566921 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| ABD426_RS03035 (ABD426_03020) | - | 567189..567626 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ABD426_RS03040 (ABD426_03025) | - | 568145..568390 (-) | 246 | WP_153279561.1 | hypothetical protein | - |
| ABD426_RS03045 (ABD426_03030) | - | 568483..569001 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ABD426_RS03050 (ABD426_03035) | - | 568980..569657 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ABD426_RS03055 (ABD426_03040) | - | 569666..570049 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABD426_RS03060 (ABD426_03045) | - | 570110..570487 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABD426_RS03065 (ABD426_03050) | - | 570529..571011 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| ABD426_RS03070 (ABD426_03055) | - | 571094..572305 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ABD426_RS03075 (ABD426_03060) | - | 572319..573821 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ABD426_RS03080 (ABD426_03065) | - | 573826..575304 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ABD426_RS03085 (ABD426_03070) | - | 575276..575515 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABD426_RS03090 (ABD426_03075) | - | 575577..575843 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ABD426_RS03095 (ABD426_03080) | - | 575969..576583 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ABD426_RS03100 (ABD426_03085) | - | 576587..577405 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABD426_RS03105 (ABD426_03090) | - | 577459..577875 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ABD426_RS03110 (ABD426_03095) | - | 577865..578197 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABD426_RS03115 (ABD426_03100) | - | 578197..578553 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABD426_RS03120 (ABD426_03105) | - | 578550..578948 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABD426_RS03125 (ABD426_03110) | - | 578948..579433 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ABD426_RS03130 (ABD426_03115) | - | 579472..579906 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ABD426_RS03135 (ABD426_03120) | - | 579910..580491 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| ABD426_RS03140 (ABD426_03125) | - | 580481..583741 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| ABD426_RS03145 (ABD426_03130) | - | 583738..584454 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ABD426_RS03150 (ABD426_03135) | - | 584451..586598 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| ABD426_RS03155 (ABD426_03140) | - | 586595..587809 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ABD426_RS03160 (ABD426_03145) | - | 587811..588125 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ABD426_RS03165 (ABD426_03150) | - | 588136..590025 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| ABD426_RS03170 (ABD426_03155) | - | 590037..590465 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ABD426_RS03175 (ABD426_03160) | - | 590468..591100 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ABD426_RS03180 (ABD426_03165) | - | 591112..591384 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ABD426_RS03185 (ABD426_03170) | - | 591381..591608 (+) | 228 | WP_011054444.1 | phage holin | - |
| ABD426_RS03190 (ABD426_03175) | - | 591724..592932 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| ABD426_RS03195 (ABD426_03180) | - | 593042..594028 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| ABD426_RS03200 (ABD426_03185) | prx | 594261..594440 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=999140 ABD426_RS03200 WP_030127450.1 594261..594440(+) (prx) [Streptococcus pyogenes strain 997/08]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=999140 ABD426_RS03200 WP_030127450.1 594261..594440(+) (prx) [Streptococcus pyogenes strain 997/08]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |