Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD406_RS07750 | Genome accession | NZ_CP155738 |
| Coordinates | 1537663..1537842 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 1510/08 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1537663..1578280 | 1537663..1537842 | within | 0 |
Gene organization within MGE regions
Location: 1537663..1578280
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD406_RS07750 (ABD406_07720) | prx | 1537663..1537842 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD406_RS07755 (ABD406_07725) | sda1 | 1538081..1539253 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD406_RS07760 (ABD406_07730) | - | 1539369..1540565 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD406_RS07765 (ABD406_07735) | - | 1540676..1540861 (-) | 186 | WP_021341107.1 | holin | - |
| ABD406_RS07770 (ABD406_07740) | - | 1540858..1541157 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD406_RS07775 (ABD406_07745) | - | 1541168..1541788 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD406_RS07780 (ABD406_07750) | - | 1541791..1541952 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD406_RS07785 (ABD406_07755) | - | 1541961..1543868 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD406_RS07790 (ABD406_07760) | - | 1543879..1544514 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD406_RS07795 (ABD406_07765) | - | 1544514..1545569 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD406_RS07800 (ABD406_07770) | - | 1545566..1547548 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD406_RS07805 (ABD406_07775) | - | 1547558..1548400 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD406_RS07810 (ABD406_07780) | - | 1548412..1552794 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD406_RS07815 (ABD406_07785) | - | 1552809..1553042 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD406_RS07820 (ABD406_07790) | - | 1553117..1553572 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD406_RS07825 (ABD406_07795) | - | 1553626..1554225 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD406_RS07830 (ABD406_07800) | - | 1554237..1554596 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD406_RS07835 (ABD406_07805) | - | 1554600..1554944 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD406_RS07840 (ABD406_07810) | - | 1554941..1555219 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD406_RS07845 (ABD406_07815) | - | 1555230..1555586 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD406_RS07850 (ABD406_07820) | - | 1555598..1556485 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD406_RS07855 (ABD406_07825) | - | 1556498..1557067 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD406_RS07860 (ABD406_07830) | - | 1557223..1557489 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD406_RS07865 (ABD406_07835) | - | 1557492..1557680 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD406_RS07870 (ABD406_07840) | - | 1557711..1559156 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD406_RS07875 (ABD406_07845) | - | 1559116..1560648 (-) | 1533 | WP_369303517.1 | phage portal protein | - |
| ABD406_RS07880 (ABD406_07850) | - | 1560664..1561941 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD406_RS07885 (ABD406_07855) | - | 1561931..1562383 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD406_RS07890 (ABD406_07860) | - | 1562473..1562889 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD406_RS07895 (ABD406_07865) | - | 1562886..1563077 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD406_RS07900 (ABD406_07870) | - | 1563067..1563855 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD406_RS07905 (ABD406_07875) | - | 1563927..1564193 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD406_RS07910 (ABD406_07880) | - | 1564190..1564357 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD406_RS07915 (ABD406_07885) | - | 1564358..1565680 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD406_RS07920 (ABD406_07890) | - | 1565677..1565952 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD406_RS07925 (ABD406_07895) | - | 1566339..1568723 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD406_RS07930 (ABD406_07900) | - | 1568728..1570650 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD406_RS07935 (ABD406_07905) | - | 1570693..1571250 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD406_RS07940 (ABD406_07910) | - | 1571261..1571659 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD406_RS07945 (ABD406_07915) | - | 1571663..1572817 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD406_RS07950 (ABD406_07920) | - | 1572817..1573116 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD406_RS07955 (ABD406_07925) | - | 1573204..1573407 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD406_RS07960 (ABD406_07930) | - | 1573554..1573940 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD406_RS07965 (ABD406_07935) | - | 1573937..1574140 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD406_RS07970 (ABD406_07940) | - | 1574133..1574303 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD406_RS07975 (ABD406_07945) | - | 1574300..1574575 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD406_RS07980 (ABD406_07950) | - | 1574637..1574852 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD406_RS07985 (ABD406_07955) | - | 1574900..1575313 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD406_RS07990 (ABD406_07960) | - | 1575294..1575449 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD406_RS07995 (ABD406_07965) | - | 1575724..1576125 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| ABD406_RS08000 (ABD406_07970) | - | 1576139..1576522 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD406_RS08005 (ABD406_07975) | - | 1576533..1577084 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD406_RS08010 (ABD406_07980) | - | 1577201..1578280 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=999098 ABD406_RS07750 WP_002988813.1 1537663..1537842(-) (prx) [Streptococcus pyogenes strain 1510/08]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=999098 ABD406_RS07750 WP_002988813.1 1537663..1537842(-) (prx) [Streptococcus pyogenes strain 1510/08]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |