Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD406_RS03195 | Genome accession | NZ_CP155738 |
| Coordinates | 594020..594199 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 1510/08 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 547428..594261 | 594020..594199 | within | 0 |
Gene organization within MGE regions
Location: 547428..594261
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD406_RS02875 (ABD406_02860) | - | 547428..548369 (-) | 942 | WP_002985305.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| ABD406_RS02880 (ABD406_02865) | - | 548763..549212 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| ABD406_RS02885 (ABD406_02870) | - | 549387..549671 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| ABD406_RS02890 (ABD406_02875) | - | 549664..550926 (+) | 1263 | WP_050336105.1 | chloride channel protein | - |
| ABD406_RS02895 (ABD406_02880) | rplS | 551041..551388 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| ABD406_RS02905 (ABD406_02890) | - | 551751..552827 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| ABD406_RS02910 (ABD406_02895) | - | 552946..553467 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| ABD406_RS02915 (ABD406_02900) | - | 553478..553855 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD406_RS02920 (ABD406_02905) | - | 553839..554198 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| ABD406_RS02925 (ABD406_02910) | - | 554386..554604 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| ABD406_RS02930 (ABD406_02915) | - | 554704..554934 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| ABD406_RS02935 (ABD406_02920) | - | 555071..555289 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| ABD406_RS02940 (ABD406_02925) | - | 555291..555533 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| ABD406_RS02945 (ABD406_02930) | - | 555517..556836 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| ABD406_RS02950 (ABD406_02935) | - | 556851..557933 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| ABD406_RS02955 (ABD406_02940) | - | 557972..558106 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| ABD406_RS02960 (ABD406_02945) | - | 558128..558721 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| ABD406_RS02965 (ABD406_02950) | - | 558721..560304 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| ABD406_RS02970 (ABD406_02955) | - | 560317..560511 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| ABD406_RS02975 (ABD406_02960) | - | 560534..562777 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| ABD406_RS02980 (ABD406_02965) | - | 563069..563251 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| ABD406_RS02985 (ABD406_02970) | - | 563244..563639 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABD406_RS02990 (ABD406_02975) | - | 563636..563860 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| ABD406_RS02995 (ABD406_02980) | - | 563863..564048 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| ABD406_RS03000 (ABD406_02985) | - | 564045..564296 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| ABD406_RS03005 (ABD406_02990) | - | 564280..564684 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| ABD406_RS03010 (ABD406_02995) | - | 564681..564965 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| ABD406_RS03015 (ABD406_03000) | - | 564967..565599 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ABD406_RS03020 (ABD406_03005) | - | 565602..566312 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| ABD406_RS03025 (ABD406_03010) | - | 566309..566680 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| ABD406_RS03030 (ABD406_03015) | - | 566948..567385 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ABD406_RS03035 (ABD406_03020) | - | 567904..568149 (-) | 246 | WP_153279561.1 | hypothetical protein | - |
| ABD406_RS03040 (ABD406_03025) | - | 568242..568760 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ABD406_RS03045 (ABD406_03030) | - | 568739..569416 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ABD406_RS03050 (ABD406_03035) | - | 569425..569808 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABD406_RS03055 (ABD406_03040) | - | 569869..570246 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABD406_RS03060 (ABD406_03045) | - | 570288..570770 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| ABD406_RS03065 (ABD406_03050) | - | 570853..572064 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ABD406_RS03070 (ABD406_03055) | - | 572078..573580 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ABD406_RS03075 (ABD406_03060) | - | 573585..575063 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ABD406_RS03080 (ABD406_03065) | - | 575035..575274 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABD406_RS03085 (ABD406_03070) | - | 575336..575602 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ABD406_RS03090 (ABD406_03075) | - | 575728..576342 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ABD406_RS03095 (ABD406_03080) | - | 576346..577164 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABD406_RS03100 (ABD406_03085) | - | 577218..577634 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ABD406_RS03105 (ABD406_03090) | - | 577624..577956 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABD406_RS03110 (ABD406_03095) | - | 577956..578312 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABD406_RS03115 (ABD406_03100) | - | 578309..578707 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABD406_RS03120 (ABD406_03105) | - | 578707..579192 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ABD406_RS03125 (ABD406_03110) | - | 579231..579665 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ABD406_RS03130 (ABD406_03115) | - | 579669..580250 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| ABD406_RS03135 (ABD406_03120) | - | 580240..583500 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| ABD406_RS03140 (ABD406_03125) | - | 583497..584213 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ABD406_RS03145 (ABD406_03130) | - | 584210..586357 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| ABD406_RS03150 (ABD406_03135) | - | 586354..587568 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ABD406_RS03155 (ABD406_03140) | - | 587570..587884 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ABD406_RS03160 (ABD406_03145) | - | 587895..589784 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| ABD406_RS03165 (ABD406_03150) | - | 589796..590224 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ABD406_RS03170 (ABD406_03155) | - | 590227..590859 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ABD406_RS03175 (ABD406_03160) | - | 590871..591143 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ABD406_RS03180 (ABD406_03165) | - | 591140..591367 (+) | 228 | WP_011054444.1 | phage holin | - |
| ABD406_RS03185 (ABD406_03170) | - | 591483..592691 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| ABD406_RS03190 (ABD406_03175) | - | 592801..593787 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| ABD406_RS03195 (ABD406_03180) | prx | 594020..594199 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=999081 ABD406_RS03195 WP_030127450.1 594020..594199(+) (prx) [Streptococcus pyogenes strain 1510/08]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=999081 ABD406_RS03195 WP_030127450.1 594020..594199(+) (prx) [Streptococcus pyogenes strain 1510/08]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |