Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD412_RS07735 | Genome accession | NZ_CP155737 |
| Coordinates | 1537310..1537489 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 9606/11 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1537310..1577927 | 1537310..1537489 | within | 0 |
Gene organization within MGE regions
Location: 1537310..1577927
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD412_RS07735 (ABD412_07705) | prx | 1537310..1537489 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD412_RS07740 (ABD412_07710) | sda1 | 1537728..1538900 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD412_RS07745 (ABD412_07715) | - | 1539016..1540212 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD412_RS07750 (ABD412_07720) | - | 1540323..1540508 (-) | 186 | WP_021341107.1 | holin | - |
| ABD412_RS07755 (ABD412_07725) | - | 1540505..1540804 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD412_RS07760 (ABD412_07730) | - | 1540815..1541435 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD412_RS07765 (ABD412_07735) | - | 1541438..1541599 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD412_RS07770 (ABD412_07740) | - | 1541608..1543515 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD412_RS07775 (ABD412_07745) | - | 1543526..1544161 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD412_RS07780 (ABD412_07750) | - | 1544161..1545216 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD412_RS07785 (ABD412_07755) | - | 1545213..1547195 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD412_RS07790 (ABD412_07760) | - | 1547205..1548047 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD412_RS07795 (ABD412_07765) | - | 1548059..1552441 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD412_RS07800 (ABD412_07770) | - | 1552456..1552689 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD412_RS07805 (ABD412_07775) | - | 1552764..1553219 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD412_RS07810 (ABD412_07780) | - | 1553273..1553872 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD412_RS07815 (ABD412_07785) | - | 1553884..1554243 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD412_RS07820 (ABD412_07790) | - | 1554247..1554591 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD412_RS07825 (ABD412_07795) | - | 1554588..1554866 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD412_RS07830 (ABD412_07800) | - | 1554877..1555233 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD412_RS07835 (ABD412_07805) | - | 1555245..1556132 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD412_RS07840 (ABD412_07810) | - | 1556145..1556714 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD412_RS07845 (ABD412_07815) | - | 1556870..1557136 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD412_RS07850 (ABD412_07820) | - | 1557139..1557327 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD412_RS07855 (ABD412_07825) | - | 1557358..1558803 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD412_RS07860 (ABD412_07830) | - | 1558763..1560295 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD412_RS07865 (ABD412_07835) | - | 1560311..1561588 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD412_RS07870 (ABD412_07840) | - | 1561578..1562030 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD412_RS07875 (ABD412_07845) | - | 1562120..1562536 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD412_RS07880 (ABD412_07850) | - | 1562533..1562724 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD412_RS07885 (ABD412_07855) | - | 1562714..1563502 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD412_RS07890 (ABD412_07860) | - | 1563574..1563840 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD412_RS07895 (ABD412_07865) | - | 1563837..1564004 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD412_RS07900 (ABD412_07870) | - | 1564005..1565327 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD412_RS07905 (ABD412_07875) | - | 1565324..1565599 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD412_RS07910 (ABD412_07880) | - | 1565986..1568370 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD412_RS07915 (ABD412_07885) | - | 1568375..1570297 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD412_RS07920 (ABD412_07890) | - | 1570340..1570897 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD412_RS07925 (ABD412_07895) | - | 1570908..1571306 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD412_RS07930 (ABD412_07900) | - | 1571310..1572464 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD412_RS07935 (ABD412_07905) | - | 1572464..1572763 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD412_RS07940 (ABD412_07910) | - | 1572851..1573054 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD412_RS07945 (ABD412_07915) | - | 1573201..1573587 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD412_RS07950 (ABD412_07920) | - | 1573584..1573787 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD412_RS07955 (ABD412_07925) | - | 1573780..1573950 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD412_RS07960 (ABD412_07930) | - | 1573947..1574222 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD412_RS07965 (ABD412_07935) | - | 1574284..1574499 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD412_RS07970 (ABD412_07940) | - | 1574547..1574960 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD412_RS07975 (ABD412_07945) | - | 1574941..1575096 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD412_RS07980 (ABD412_07950) | - | 1575371..1575772 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| ABD412_RS07985 (ABD412_07955) | - | 1575786..1576169 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD412_RS07990 (ABD412_07960) | - | 1576180..1576731 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD412_RS07995 (ABD412_07965) | - | 1576848..1577927 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=999040 ABD412_RS07735 WP_002988813.1 1537310..1537489(-) (prx) [Streptococcus pyogenes strain 9606/11]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=999040 ABD412_RS07735 WP_002988813.1 1537310..1537489(-) (prx) [Streptococcus pyogenes strain 9606/11]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |