Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD412_RS03195 | Genome accession | NZ_CP155737 |
| Coordinates | 594265..594444 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 9606/11 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 547673..594506 | 594265..594444 | within | 0 |
Gene organization within MGE regions
Location: 547673..594506
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD412_RS02875 (ABD412_02860) | - | 547673..548614 (-) | 942 | WP_002985305.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| ABD412_RS02880 (ABD412_02865) | - | 549008..549457 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| ABD412_RS02885 (ABD412_02870) | - | 549632..549916 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| ABD412_RS02890 (ABD412_02875) | - | 549909..551171 (+) | 1263 | WP_050336105.1 | chloride channel protein | - |
| ABD412_RS02895 (ABD412_02880) | rplS | 551286..551633 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| ABD412_RS02905 (ABD412_02890) | - | 551996..553072 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| ABD412_RS02910 (ABD412_02895) | - | 553191..553712 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| ABD412_RS02915 (ABD412_02900) | - | 553723..554100 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD412_RS02920 (ABD412_02905) | - | 554084..554443 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| ABD412_RS02925 (ABD412_02910) | - | 554631..554849 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| ABD412_RS02930 (ABD412_02915) | - | 554949..555179 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| ABD412_RS02935 (ABD412_02920) | - | 555316..555534 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| ABD412_RS02940 (ABD412_02925) | - | 555536..555778 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| ABD412_RS02945 (ABD412_02930) | - | 555762..557081 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| ABD412_RS02950 (ABD412_02935) | - | 557096..558178 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| ABD412_RS02955 (ABD412_02940) | - | 558217..558351 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| ABD412_RS02960 (ABD412_02945) | - | 558373..558966 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| ABD412_RS02965 (ABD412_02950) | - | 558966..560549 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| ABD412_RS02970 (ABD412_02955) | - | 560562..560756 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| ABD412_RS02975 (ABD412_02960) | - | 560779..563022 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| ABD412_RS02980 (ABD412_02965) | - | 563314..563496 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| ABD412_RS02985 (ABD412_02970) | - | 563489..563884 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABD412_RS02990 (ABD412_02975) | - | 563881..564105 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| ABD412_RS02995 (ABD412_02980) | - | 564108..564293 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| ABD412_RS03000 (ABD412_02985) | - | 564290..564541 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| ABD412_RS03005 (ABD412_02990) | - | 564525..564929 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| ABD412_RS03010 (ABD412_02995) | - | 564926..565210 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| ABD412_RS03015 (ABD412_03000) | - | 565212..565844 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ABD412_RS03020 (ABD412_03005) | - | 565847..566557 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| ABD412_RS03025 (ABD412_03010) | - | 566554..566925 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| ABD412_RS03030 (ABD412_03015) | - | 567193..567630 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ABD412_RS03035 (ABD412_03020) | - | 568149..568406 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| ABD412_RS03040 (ABD412_03025) | - | 568487..569005 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ABD412_RS03045 (ABD412_03030) | - | 568984..569661 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ABD412_RS03050 (ABD412_03035) | - | 569670..570053 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABD412_RS03055 (ABD412_03040) | - | 570114..570491 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABD412_RS03060 (ABD412_03045) | - | 570533..571015 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| ABD412_RS03065 (ABD412_03050) | - | 571098..572309 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ABD412_RS03070 (ABD412_03055) | - | 572323..573825 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ABD412_RS03075 (ABD412_03060) | - | 573830..575308 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ABD412_RS03080 (ABD412_03065) | - | 575280..575519 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABD412_RS03085 (ABD412_03070) | - | 575581..575847 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ABD412_RS03090 (ABD412_03075) | - | 575973..576587 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ABD412_RS03095 (ABD412_03080) | - | 576591..577409 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABD412_RS03100 (ABD412_03085) | - | 577463..577879 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ABD412_RS03105 (ABD412_03090) | - | 577869..578201 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABD412_RS03110 (ABD412_03095) | - | 578201..578557 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABD412_RS03115 (ABD412_03100) | - | 578554..578952 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABD412_RS03120 (ABD412_03105) | - | 578952..579437 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ABD412_RS03125 (ABD412_03110) | - | 579476..579910 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ABD412_RS03130 (ABD412_03115) | - | 579914..580495 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| ABD412_RS03135 (ABD412_03120) | - | 580485..583745 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| ABD412_RS03140 (ABD412_03125) | - | 583742..584458 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ABD412_RS03145 (ABD412_03130) | - | 584455..586602 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| ABD412_RS03150 (ABD412_03135) | - | 586599..587813 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ABD412_RS03155 (ABD412_03140) | - | 587815..588129 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ABD412_RS03160 (ABD412_03145) | - | 588140..590029 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| ABD412_RS03165 (ABD412_03150) | - | 590041..590469 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ABD412_RS03170 (ABD412_03155) | - | 590472..591104 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ABD412_RS03175 (ABD412_03160) | - | 591116..591388 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ABD412_RS03180 (ABD412_03165) | - | 591385..591612 (+) | 228 | WP_011054444.1 | phage holin | - |
| ABD412_RS03185 (ABD412_03170) | - | 591728..592936 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| ABD412_RS03190 (ABD412_03175) | - | 593046..594032 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| ABD412_RS03195 (ABD412_03180) | prx | 594265..594444 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=999023 ABD412_RS03195 WP_030127450.1 594265..594444(+) (prx) [Streptococcus pyogenes strain 9606/11]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=999023 ABD412_RS03195 WP_030127450.1 594265..594444(+) (prx) [Streptococcus pyogenes strain 9606/11]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |