Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD407_RS07410 | Genome accession | NZ_CP155736 |
| Coordinates | 1498894..1499073 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 1966/14 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1498894..1539511 | 1498894..1499073 | within | 0 |
Gene organization within MGE regions
Location: 1498894..1539511
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD407_RS07410 (ABD407_07380) | prx | 1498894..1499073 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD407_RS07415 (ABD407_07385) | sda1 | 1499312..1500484 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD407_RS07420 (ABD407_07390) | - | 1500600..1501796 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD407_RS07425 (ABD407_07395) | - | 1501907..1502092 (-) | 186 | WP_021341107.1 | holin | - |
| ABD407_RS07430 (ABD407_07400) | - | 1502089..1502388 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD407_RS07435 (ABD407_07405) | - | 1502399..1503019 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD407_RS07440 (ABD407_07410) | - | 1503022..1503183 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD407_RS07445 (ABD407_07415) | - | 1503192..1505099 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD407_RS07450 (ABD407_07420) | - | 1505110..1505745 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD407_RS07455 (ABD407_07425) | - | 1505745..1506800 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD407_RS07460 (ABD407_07430) | - | 1506797..1508779 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD407_RS07465 (ABD407_07435) | - | 1508789..1509631 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD407_RS07470 (ABD407_07440) | - | 1509643..1514025 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD407_RS07475 (ABD407_07445) | - | 1514040..1514273 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD407_RS07480 (ABD407_07450) | - | 1514348..1514803 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD407_RS07485 (ABD407_07455) | - | 1514857..1515456 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD407_RS07490 (ABD407_07460) | - | 1515468..1515827 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD407_RS07495 (ABD407_07465) | - | 1515831..1516175 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD407_RS07500 (ABD407_07470) | - | 1516172..1516450 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD407_RS07505 (ABD407_07475) | - | 1516461..1516817 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD407_RS07510 (ABD407_07480) | - | 1516829..1517716 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD407_RS07515 (ABD407_07485) | - | 1517729..1518298 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD407_RS07520 (ABD407_07490) | - | 1518454..1518720 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD407_RS07525 (ABD407_07495) | - | 1518723..1518911 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD407_RS07530 (ABD407_07500) | - | 1518942..1520387 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD407_RS07535 (ABD407_07505) | - | 1520347..1521879 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD407_RS07540 (ABD407_07510) | - | 1521895..1523172 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD407_RS07545 (ABD407_07515) | - | 1523162..1523614 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD407_RS07550 (ABD407_07520) | - | 1523704..1524120 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD407_RS07555 (ABD407_07525) | - | 1524117..1524308 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD407_RS07560 (ABD407_07530) | - | 1524298..1525086 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD407_RS07565 (ABD407_07535) | - | 1525158..1525424 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD407_RS07570 (ABD407_07540) | - | 1525421..1525588 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD407_RS07575 (ABD407_07545) | - | 1525589..1526911 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD407_RS07580 (ABD407_07550) | - | 1526908..1527183 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD407_RS07585 (ABD407_07555) | - | 1527570..1529954 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD407_RS07590 (ABD407_07560) | - | 1529959..1531881 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD407_RS07595 (ABD407_07565) | - | 1531924..1532481 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD407_RS07600 (ABD407_07570) | - | 1532492..1532890 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD407_RS07605 (ABD407_07575) | - | 1532894..1534048 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD407_RS07610 (ABD407_07580) | - | 1534048..1534347 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD407_RS07615 (ABD407_07585) | - | 1534435..1534638 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD407_RS07620 (ABD407_07590) | - | 1534785..1535171 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD407_RS07625 (ABD407_07595) | - | 1535168..1535371 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD407_RS07630 (ABD407_07600) | - | 1535364..1535534 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD407_RS07635 (ABD407_07605) | - | 1535531..1535806 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD407_RS07640 (ABD407_07610) | - | 1535868..1536083 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD407_RS07645 (ABD407_07615) | - | 1536131..1536544 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD407_RS07650 (ABD407_07620) | - | 1536525..1536680 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD407_RS07655 (ABD407_07625) | - | 1537006..1537356 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ABD407_RS07660 (ABD407_07630) | - | 1537370..1537753 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD407_RS07665 (ABD407_07635) | - | 1537764..1538315 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD407_RS07670 (ABD407_07640) | - | 1538432..1539511 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=998981 ABD407_RS07410 WP_002988813.1 1498894..1499073(-) (prx) [Streptococcus pyogenes strain 1966/14]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=998981 ABD407_RS07410 WP_002988813.1 1498894..1499073(-) (prx) [Streptococcus pyogenes strain 1966/14]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |