Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD408_RS07240 | Genome accession | NZ_CP155735 |
| Coordinates | 1462380..1462559 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 4958/15 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1462380..1502997 | 1462380..1462559 | within | 0 |
Gene organization within MGE regions
Location: 1462380..1502997
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD408_RS07240 (ABD408_07210) | prx | 1462380..1462559 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD408_RS07245 (ABD408_07215) | sda1 | 1462798..1463970 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD408_RS07250 (ABD408_07220) | - | 1464086..1465282 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD408_RS07255 (ABD408_07225) | - | 1465393..1465578 (-) | 186 | WP_021341107.1 | holin | - |
| ABD408_RS07260 (ABD408_07230) | - | 1465575..1465874 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD408_RS07265 (ABD408_07235) | - | 1465885..1466505 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD408_RS07270 (ABD408_07240) | - | 1466508..1466669 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD408_RS07275 (ABD408_07245) | - | 1466678..1468585 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD408_RS07280 (ABD408_07250) | - | 1468596..1469231 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD408_RS07285 (ABD408_07255) | - | 1469231..1470286 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD408_RS07290 (ABD408_07260) | - | 1470283..1472265 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD408_RS07295 (ABD408_07265) | - | 1472275..1473117 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD408_RS07300 (ABD408_07270) | - | 1473129..1477511 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD408_RS07305 (ABD408_07275) | - | 1477526..1477759 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD408_RS07310 (ABD408_07280) | - | 1477834..1478289 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD408_RS07315 (ABD408_07285) | - | 1478343..1478942 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD408_RS07320 (ABD408_07290) | - | 1478954..1479313 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD408_RS07325 (ABD408_07295) | - | 1479317..1479661 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD408_RS07330 (ABD408_07300) | - | 1479658..1479936 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD408_RS07335 (ABD408_07305) | - | 1479947..1480303 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD408_RS07340 (ABD408_07310) | - | 1480315..1481202 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD408_RS07345 (ABD408_07315) | - | 1481215..1481784 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD408_RS07350 (ABD408_07320) | - | 1481940..1482206 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD408_RS07355 (ABD408_07325) | - | 1482209..1482397 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD408_RS07360 (ABD408_07330) | - | 1482428..1483873 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD408_RS07365 (ABD408_07335) | - | 1483833..1485365 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD408_RS07370 (ABD408_07340) | - | 1485381..1486658 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD408_RS07375 (ABD408_07345) | - | 1486648..1487100 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD408_RS07380 (ABD408_07350) | - | 1487190..1487606 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD408_RS07385 (ABD408_07355) | - | 1487603..1487794 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD408_RS07390 (ABD408_07360) | - | 1487784..1488572 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD408_RS07395 (ABD408_07365) | - | 1488644..1488910 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD408_RS07400 (ABD408_07370) | - | 1488907..1489074 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD408_RS07405 (ABD408_07375) | - | 1489075..1490397 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD408_RS07410 (ABD408_07380) | - | 1490394..1490669 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD408_RS07415 (ABD408_07385) | - | 1491056..1493440 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD408_RS07420 (ABD408_07390) | - | 1493445..1495367 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD408_RS07425 (ABD408_07395) | - | 1495410..1495967 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD408_RS07430 (ABD408_07400) | - | 1495978..1496376 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD408_RS07435 (ABD408_07405) | - | 1496380..1497534 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD408_RS07440 (ABD408_07410) | - | 1497534..1497833 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD408_RS07445 (ABD408_07415) | - | 1497921..1498124 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD408_RS07450 (ABD408_07420) | - | 1498271..1498657 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD408_RS07455 (ABD408_07425) | - | 1498654..1498857 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD408_RS07460 (ABD408_07430) | - | 1498850..1499020 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD408_RS07465 (ABD408_07435) | - | 1499017..1499292 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD408_RS07470 (ABD408_07440) | - | 1499354..1499569 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD408_RS07475 (ABD408_07445) | - | 1499617..1500030 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD408_RS07480 (ABD408_07450) | - | 1500011..1500166 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD408_RS07485 (ABD408_07455) | - | 1500492..1500842 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ABD408_RS07490 (ABD408_07460) | - | 1500856..1501239 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD408_RS07495 (ABD408_07465) | - | 1501250..1501801 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD408_RS07500 (ABD408_07470) | - | 1501918..1502997 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=998924 ABD408_RS07240 WP_002988813.1 1462380..1462559(-) (prx) [Streptococcus pyogenes strain 4958/15]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=998924 ABD408_RS07240 WP_002988813.1 1462380..1462559(-) (prx) [Streptococcus pyogenes strain 4958/15]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |