Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD408_RS03130 | Genome accession | NZ_CP155735 |
| Coordinates | 588397..588576 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 4958/15 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 546128..591944 | 588397..588576 | within | 0 |
Gene organization within MGE regions
Location: 546128..591944
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD408_RS02840 (ABD408_02825) | - | 546128..547204 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| ABD408_RS02845 (ABD408_02830) | - | 547323..547844 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| ABD408_RS02850 (ABD408_02835) | - | 547855..548232 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD408_RS02855 (ABD408_02840) | - | 548216..548575 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| ABD408_RS02860 (ABD408_02845) | - | 548763..548981 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| ABD408_RS02865 (ABD408_02850) | - | 549081..549311 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| ABD408_RS02870 (ABD408_02855) | - | 549448..549666 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| ABD408_RS02875 (ABD408_02860) | - | 549668..549910 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| ABD408_RS02880 (ABD408_02865) | - | 549894..551213 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| ABD408_RS02885 (ABD408_02870) | - | 551228..552310 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| ABD408_RS02890 (ABD408_02875) | - | 552349..552483 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| ABD408_RS02895 (ABD408_02880) | - | 552505..553098 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| ABD408_RS02900 (ABD408_02885) | - | 553098..554681 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| ABD408_RS02905 (ABD408_02890) | - | 554694..554888 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| ABD408_RS02910 (ABD408_02895) | - | 554911..557154 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| ABD408_RS02915 (ABD408_02900) | - | 557446..557628 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| ABD408_RS02920 (ABD408_02905) | - | 557621..558016 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABD408_RS02925 (ABD408_02910) | - | 558013..558237 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| ABD408_RS02930 (ABD408_02915) | - | 558240..558425 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| ABD408_RS02935 (ABD408_02920) | - | 558422..558673 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| ABD408_RS02940 (ABD408_02925) | - | 558657..559061 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| ABD408_RS02945 (ABD408_02930) | - | 559058..559342 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| ABD408_RS02950 (ABD408_02935) | - | 559344..559976 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ABD408_RS02955 (ABD408_02940) | - | 559979..560689 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| ABD408_RS02960 (ABD408_02945) | - | 560686..561057 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| ABD408_RS02965 (ABD408_02950) | - | 561325..561762 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ABD408_RS02970 (ABD408_02955) | - | 562281..562538 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| ABD408_RS02975 (ABD408_02960) | - | 562619..563137 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| ABD408_RS02980 (ABD408_02965) | - | 563116..563793 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ABD408_RS02985 (ABD408_02970) | - | 563802..564185 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABD408_RS02990 (ABD408_02975) | - | 564246..564623 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABD408_RS02995 (ABD408_02980) | - | 564665..565147 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| ABD408_RS03000 (ABD408_02985) | - | 565230..566441 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| ABD408_RS03005 (ABD408_02990) | - | 566455..567957 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| ABD408_RS03010 (ABD408_02995) | - | 567962..569440 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| ABD408_RS03015 (ABD408_03000) | - | 569412..569651 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABD408_RS03020 (ABD408_03005) | - | 569713..569979 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| ABD408_RS03025 (ABD408_03010) | - | 570105..570719 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| ABD408_RS03030 (ABD408_03015) | - | 570723..571541 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABD408_RS03035 (ABD408_03020) | - | 571595..572011 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| ABD408_RS03040 (ABD408_03025) | - | 572001..572333 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABD408_RS03045 (ABD408_03030) | - | 572333..572689 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABD408_RS03050 (ABD408_03035) | - | 572686..573084 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABD408_RS03055 (ABD408_03040) | - | 573084..573569 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| ABD408_RS03060 (ABD408_03045) | - | 573608..574042 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| ABD408_RS03065 (ABD408_03050) | - | 574046..574627 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| ABD408_RS03070 (ABD408_03055) | - | 574617..577877 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| ABD408_RS03075 (ABD408_03060) | - | 577874..578590 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| ABD408_RS03080 (ABD408_03065) | - | 578587..580734 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| ABD408_RS03085 (ABD408_03070) | - | 580731..581945 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ABD408_RS03090 (ABD408_03075) | - | 581947..582261 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ABD408_RS03095 (ABD408_03080) | - | 582272..584161 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| ABD408_RS03100 (ABD408_03085) | - | 584173..584601 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ABD408_RS03105 (ABD408_03090) | - | 584604..585236 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| ABD408_RS03110 (ABD408_03095) | - | 585248..585520 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ABD408_RS03115 (ABD408_03100) | - | 585517..585744 (+) | 228 | WP_011054444.1 | phage holin | - |
| ABD408_RS03120 (ABD408_03105) | - | 585860..587068 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| ABD408_RS03125 (ABD408_03110) | - | 587178..588164 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| ABD408_RS03130 (ABD408_03115) | prx | 588397..588576 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
| ABD408_RS03135 (ABD408_03120) | - | 588757..589077 (-) | 321 | Protein_581 | site-specific integrase | - |
| ABD408_RS03140 (ABD408_03125) | - | 589431..589991 (+) | 561 | WP_023612339.1 | HAD-IA family hydrolase | - |
| ABD408_RS03145 (ABD408_03130) | gyrB | 589992..591944 (+) | 1953 | WP_038431254.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=998909 ABD408_RS03130 WP_030127450.1 588397..588576(+) (prx) [Streptococcus pyogenes strain 4958/15]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=998909 ABD408_RS03130 WP_030127450.1 588397..588576(+) (prx) [Streptococcus pyogenes strain 4958/15]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |