Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD411_RS08215 | Genome accession | NZ_CP155734 |
| Coordinates | 1602609..1602788 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 8373/17 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1594726..1643226 | 1602609..1602788 | within | 0 |
Gene organization within MGE regions
Location: 1594726..1643226
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD411_RS08175 (ABD411_08145) | - | 1594726..1595160 (-) | 435 | WP_011054926.1 | CopY/TcrY family copper transport repressor | - |
| ABD411_RS08180 (ABD411_08150) | - | 1595344..1596318 (+) | 975 | WP_227868640.1 | alpha/beta hydrolase fold domain-containing protein | - |
| ABD411_RS08185 (ABD411_08155) | rbfA | 1596452..1596802 (-) | 351 | WP_023611916.1 | 30S ribosome-binding factor RbfA | - |
| ABD411_RS08190 (ABD411_08160) | infB | 1597008..1599869 (-) | 2862 | WP_023611939.1 | translation initiation factor IF-2 | - |
| ABD411_RS08195 (ABD411_08165) | - | 1599889..1600191 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| ABD411_RS08200 (ABD411_08170) | rnpM | 1600184..1600480 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| ABD411_RS08205 (ABD411_08175) | nusA | 1600496..1601653 (-) | 1158 | WP_023611711.1 | transcription termination factor NusA | - |
| ABD411_RS08210 (ABD411_08180) | rimP | 1601828..1602364 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| ABD411_RS08215 (ABD411_08185) | prx | 1602609..1602788 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ABD411_RS08220 (ABD411_08190) | sda1 | 1603027..1604199 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ABD411_RS08225 (ABD411_08195) | - | 1604315..1605511 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ABD411_RS08230 (ABD411_08200) | - | 1605622..1605807 (-) | 186 | WP_021341107.1 | holin | - |
| ABD411_RS08235 (ABD411_08205) | - | 1605804..1606103 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ABD411_RS08240 (ABD411_08210) | - | 1606114..1606734 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ABD411_RS08245 (ABD411_08215) | - | 1606737..1606898 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ABD411_RS08250 (ABD411_08220) | - | 1606907..1608814 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| ABD411_RS08255 (ABD411_08225) | - | 1608825..1609460 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| ABD411_RS08260 (ABD411_08230) | - | 1609460..1610515 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ABD411_RS08265 (ABD411_08235) | - | 1610512..1612494 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ABD411_RS08270 (ABD411_08240) | - | 1612504..1613346 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ABD411_RS08275 (ABD411_08245) | - | 1613358..1617740 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ABD411_RS08280 (ABD411_08250) | - | 1617755..1617988 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ABD411_RS08285 (ABD411_08255) | - | 1618063..1618518 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ABD411_RS08290 (ABD411_08260) | - | 1618572..1619171 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ABD411_RS08295 (ABD411_08265) | - | 1619183..1619542 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ABD411_RS08300 (ABD411_08270) | - | 1619546..1619890 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABD411_RS08305 (ABD411_08275) | - | 1619887..1620165 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ABD411_RS08310 (ABD411_08280) | - | 1620176..1620532 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ABD411_RS08315 (ABD411_08285) | - | 1620544..1621431 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ABD411_RS08320 (ABD411_08290) | - | 1621444..1622013 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ABD411_RS08325 (ABD411_08295) | - | 1622169..1622435 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ABD411_RS08330 (ABD411_08300) | - | 1622438..1622626 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ABD411_RS08335 (ABD411_08305) | - | 1622657..1624102 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ABD411_RS08340 (ABD411_08310) | - | 1624062..1625594 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ABD411_RS08345 (ABD411_08315) | - | 1625610..1626887 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ABD411_RS08350 (ABD411_08320) | - | 1626877..1627329 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ABD411_RS08355 (ABD411_08325) | - | 1627419..1627835 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ABD411_RS08360 (ABD411_08330) | - | 1627832..1628023 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ABD411_RS08365 (ABD411_08335) | - | 1628013..1628801 (-) | 789 | WP_229363273.1 | site-specific DNA-methyltransferase | - |
| ABD411_RS08370 (ABD411_08340) | - | 1628873..1629139 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ABD411_RS08375 (ABD411_08345) | - | 1629136..1629303 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ABD411_RS08380 (ABD411_08350) | - | 1629304..1630626 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ABD411_RS08385 (ABD411_08355) | - | 1630623..1630898 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ABD411_RS08390 (ABD411_08360) | - | 1631285..1633669 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ABD411_RS08395 (ABD411_08365) | - | 1633674..1635596 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ABD411_RS08400 (ABD411_08370) | - | 1635639..1636196 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ABD411_RS08405 (ABD411_08375) | - | 1636207..1636605 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ABD411_RS08410 (ABD411_08380) | - | 1636609..1637763 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ABD411_RS08415 (ABD411_08385) | - | 1637763..1638062 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ABD411_RS08420 (ABD411_08390) | - | 1638150..1638353 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ABD411_RS08425 (ABD411_08395) | - | 1638500..1638886 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ABD411_RS08430 (ABD411_08400) | - | 1638883..1639086 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ABD411_RS08435 (ABD411_08405) | - | 1639079..1639249 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ABD411_RS08440 (ABD411_08410) | - | 1639246..1639521 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ABD411_RS08445 (ABD411_08415) | - | 1639583..1639798 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ABD411_RS08450 (ABD411_08420) | - | 1639846..1640259 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ABD411_RS08455 (ABD411_08425) | - | 1640240..1640395 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ABD411_RS08460 (ABD411_08430) | - | 1640721..1641071 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ABD411_RS08465 (ABD411_08435) | - | 1641085..1641468 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD411_RS08470 (ABD411_08440) | - | 1641479..1642030 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ABD411_RS08475 (ABD411_08445) | - | 1642147..1643226 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=998867 ABD411_RS08215 WP_002988813.1 1602609..1602788(-) (prx) [Streptococcus pyogenes strain 8373/17]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=998867 ABD411_RS08215 WP_002988813.1 1602609..1602788(-) (prx) [Streptococcus pyogenes strain 8373/17]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |