Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ABD411_RS03405 | Genome accession | NZ_CP155734 |
| Coordinates | 639658..639840 (+) | Length | 60 a.a. |
| NCBI ID | WP_003056293.1 | Uniprot ID | A0A5S4TFM2 |
| Organism | Streptococcus pyogenes strain 8373/17 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 599646..655509 | 639658..639840 | within | 0 |
Gene organization within MGE regions
Location: 599646..655509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD411_RS03095 (ABD411_03080) | - | 599646..600743 (-) | 1098 | WP_032463383.1 | site-specific integrase | - |
| ABD411_RS03100 (ABD411_03085) | - | 600919..601440 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| ABD411_RS03105 (ABD411_03090) | - | 601451..601831 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABD411_RS03110 (ABD411_03095) | - | 601845..602204 (-) | 360 | WP_011054768.1 | helix-turn-helix domain-containing protein | - |
| ABD411_RS03115 (ABD411_03100) | - | 602623..602718 (-) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| ABD411_RS03120 (ABD411_03105) | - | 603353..603544 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| ABD411_RS03125 (ABD411_03110) | - | 603555..604283 (+) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| ABD411_RS03130 (ABD411_03115) | - | 604316..604465 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| ABD411_RS03135 (ABD411_03120) | - | 604462..604662 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| ABD411_RS03140 (ABD411_03125) | - | 604741..604989 (+) | 249 | WP_023611035.1 | hypothetical protein | - |
| ABD411_RS03145 (ABD411_03130) | - | 604963..605178 (-) | 216 | WP_023611028.1 | hypothetical protein | - |
| ABD411_RS03150 (ABD411_03135) | - | 605284..605541 (+) | 258 | WP_032463372.1 | hypothetical protein | - |
| ABD411_RS03155 (ABD411_03140) | - | 605570..605755 (+) | 186 | WP_002986881.1 | hypothetical protein | - |
| ABD411_RS03160 (ABD411_03145) | - | 605849..606106 (+) | 258 | WP_019418742.1 | hypothetical protein | - |
| ABD411_RS03165 (ABD411_03150) | - | 606228..606638 (+) | 411 | WP_172450154.1 | DnaD domain-containing protein | - |
| ABD411_RS03170 (ABD411_03155) | - | 606619..606831 (+) | 213 | WP_002986875.1 | hypothetical protein | - |
| ABD411_RS03175 (ABD411_03160) | - | 606837..606977 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| ABD411_RS03180 (ABD411_03165) | - | 606986..607192 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| ABD411_RS03185 (ABD411_03170) | - | 607248..607577 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| ABD411_RS03190 (ABD411_03175) | - | 607580..608506 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| ABD411_RS03195 (ABD411_03180) | - | 608503..608703 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| ABD411_RS03200 (ABD411_03185) | - | 608696..609493 (+) | 798 | WP_369324685.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ABD411_RS03205 (ABD411_03190) | - | 609503..609670 (+) | 168 | WP_009880273.1 | hypothetical protein | - |
| ABD411_RS03210 (ABD411_03195) | - | 609847..610185 (+) | 339 | WP_002990067.1 | hypothetical protein | - |
| ABD411_RS03215 (ABD411_03200) | - | 610182..610694 (+) | 513 | WP_032463367.1 | phage protein | - |
| ABD411_RS03220 (ABD411_03205) | - | 610681..610866 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| ABD411_RS03225 (ABD411_03210) | - | 610871..611140 (+) | 270 | WP_032463364.1 | hypothetical protein | - |
| ABD411_RS03230 (ABD411_03215) | - | 611297..611389 (+) | 93 | Protein_587 | SAM-dependent methyltransferase | - |
| ABD411_RS03235 (ABD411_03220) | - | 611379..612143 (+) | 765 | WP_032463361.1 | site-specific DNA-methyltransferase | - |
| ABD411_RS03240 (ABD411_03225) | - | 612191..612484 (+) | 294 | WP_032460172.1 | hypothetical protein | - |
| ABD411_RS03245 (ABD411_03230) | - | 612849..613286 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| ABD411_RS03250 (ABD411_03235) | - | 613861..614118 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| ABD411_RS03255 (ABD411_03240) | - | 614199..614717 (+) | 519 | WP_076639322.1 | ParB N-terminal domain-containing protein | - |
| ABD411_RS03260 (ABD411_03245) | - | 614743..615126 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| ABD411_RS03265 (ABD411_03250) | - | 615187..615564 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ABD411_RS03270 (ABD411_03255) | - | 615606..616088 (+) | 483 | WP_369324694.1 | hypothetical protein | - |
| ABD411_RS03275 (ABD411_03260) | - | 616091..617382 (+) | 1292 | Protein_596 | PBSX family phage terminase large subunit | - |
| ABD411_RS03280 (ABD411_03265) | - | 617396..618898 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| ABD411_RS03285 (ABD411_03270) | - | 618903..620381 (+) | 1479 | WP_032463353.1 | phage minor capsid protein | - |
| ABD411_RS03290 (ABD411_03275) | - | 620353..620592 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| ABD411_RS03295 (ABD411_03280) | - | 620654..620920 (+) | 267 | WP_111694887.1 | hypothetical protein | - |
| ABD411_RS03300 (ABD411_03285) | - | 621046..621660 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| ABD411_RS03305 (ABD411_03290) | - | 621664..622482 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ABD411_RS03310 (ABD411_03295) | - | 622536..622952 (+) | 417 | WP_010922081.1 | hypothetical protein | - |
| ABD411_RS03315 (ABD411_03300) | - | 622942..623274 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| ABD411_RS03320 (ABD411_03305) | - | 623274..623630 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| ABD411_RS03325 (ABD411_03310) | - | 623627..624025 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| ABD411_RS03330 (ABD411_03315) | - | 624025..624495 (+) | 471 | WP_011527917.1 | phage tail tube protein | - |
| ABD411_RS03335 (ABD411_03320) | - | 624548..624982 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| ABD411_RS03340 (ABD411_03325) | - | 624986..625567 (+) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| ABD411_RS03345 (ABD411_03330) | - | 625557..628817 (+) | 3261 | WP_369324686.1 | tape measure protein | - |
| ABD411_RS03350 (ABD411_03335) | - | 628814..629530 (+) | 717 | WP_111674636.1 | distal tail protein Dit | - |
| ABD411_RS03355 (ABD411_03340) | - | 629527..631674 (+) | 2148 | WP_369324687.1 | phage tail spike protein | - |
| ABD411_RS03360 (ABD411_03345) | - | 631671..632894 (+) | 1224 | WP_030127718.1 | hypothetical protein | - |
| ABD411_RS03365 (ABD411_03350) | - | 632896..633210 (+) | 315 | WP_063812987.1 | hypothetical protein | - |
| ABD411_RS03370 (ABD411_03355) | - | 633221..635107 (+) | 1887 | WP_129820704.1 | gp58-like family protein | - |
| ABD411_RS03375 (ABD411_03360) | - | 635119..635550 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| ABD411_RS03380 (ABD411_03365) | - | 635553..636170 (+) | 618 | WP_085613961.1 | DUF1366 domain-containing protein | - |
| ABD411_RS03385 (ABD411_03370) | - | 636180..636452 (+) | 273 | WP_085613962.1 | hypothetical protein | - |
| ABD411_RS03390 (ABD411_03375) | - | 636449..636676 (+) | 228 | WP_003058873.1 | phage holin | - |
| ABD411_RS03395 (ABD411_03380) | - | 636792..637997 (+) | 1206 | WP_085613963.1 | glucosaminidase domain-containing protein | - |
| ABD411_RS03400 (ABD411_03385) | - | 638619..639419 (-) | 801 | WP_021340119.1 | DNA/RNA non-specific endonuclease | - |
| ABD411_RS03405 (ABD411_03390) | prx | 639658..639840 (+) | 183 | WP_003056293.1 | hypothetical protein | Regulator |
| ABD411_RS03410 (ABD411_03395) | - | 640089..640466 (+) | 378 | WP_002993028.1 | OsmC family protein | - |
| ABD411_RS03415 (ABD411_03400) | - | 640459..640845 (+) | 387 | WP_002990406.1 | YbgA family protein | - |
| ABD411_RS03420 (ABD411_03405) | - | 640918..641994 (+) | 1077 | WP_010922123.1 | FtsX-like permease family protein | - |
| ABD411_RS03425 (ABD411_03410) | - | 642004..642672 (+) | 669 | WP_011017620.1 | ABC transporter ATP-binding protein | - |
| ABD411_RS03430 (ABD411_03415) | - | 642776..643693 (-) | 918 | WP_023612345.1 | neutral zinc metallopeptidase | - |
| ABD411_RS03435 (ABD411_03420) | rexB | 643844..647059 (+) | 3216 | WP_023612325.1 | ATP-dependent nuclease subunit B | - |
| ABD411_RS03440 (ABD411_03425) | addA | 647056..650688 (+) | 3633 | WP_023612349.1 | helicase-exonuclease AddAB subunit AddA | - |
| ABD411_RS03445 (ABD411_03430) | - | 650828..651640 (+) | 813 | WP_023612321.1 | transporter substrate-binding domain-containing protein | - |
| ABD411_RS03450 (ABD411_03435) | rpsU | 651781..651957 (+) | 177 | WP_000048058.1 | 30S ribosomal protein S21 | - |
| ABD411_RS03455 (ABD411_03440) | mscL | 652085..652447 (-) | 363 | WP_014407472.1 | large conductance mechanosensitive channel protein MscL | - |
| ABD411_RS03460 (ABD411_03445) | dnaG | 652577..654391 (+) | 1815 | WP_023612436.1 | DNA primase | - |
| ABD411_RS03465 (ABD411_03450) | rpoD | 654400..655509 (+) | 1110 | WP_002985187.1 | RNA polymerase sigma factor RpoD | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6877.91 Da Isoelectric Point: 4.2840
>NTDB_id=998851 ABD411_RS03405 WP_003056293.1 639658..639840(+) (prx) [Streptococcus pyogenes strain 8373/17]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEPVKPWEILTEVIVEAVLRELDK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEPVKPWEILTEVIVEAVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=998851 ABD411_RS03405 WP_003056293.1 639658..639840(+) (prx) [Streptococcus pyogenes strain 8373/17]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTGAAACCGTGGGAAATTTTGACTGAAGTAATAGTAGAAGCAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTGAAACCGTGGGAAATTTTGACTGAAGTAATAGTAGAAGCAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
68.333 |
0.533 |