Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37642_RS05975 | Genome accession | NZ_CP151468 |
| Coordinates | 1175096..1175278 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37642 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1175096..1208582 | 1175096..1175278 | within | 0 |
Gene organization within MGE regions
Location: 1175096..1208582
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37642_RS05975 (MGAS37642_02460) | prx | 1175096..1175278 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37642_RS05980 (MGAS37642_02462) | sda3 | 1175517..1176317 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37642_RS05985 (MGAS37642_02464) | - | 1176588..1177022 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37642_RS05990 (MGAS37642_02466) | - | 1177092..1178297 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37642_RS05995 (MGAS37642_02468) | - | 1178413..1178640 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37642_RS06000 (MGAS37642_02470) | - | 1178637..1178912 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37642_RS06005 (MGAS37642_02472) | - | 1178922..1179539 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37642_RS06010 (MGAS37642_02474) | - | 1179536..1179973 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37642_RS06015 (MGAS37642_02476) | - | 1179985..1181853 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37642_RS06020 (MGAS37642_02478) | - | 1181850..1182545 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37642_RS06025 (MGAS37642_02480) | - | 1182542..1184899 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37642_RS06030 (MGAS37642_02482) | - | 1184899..1185270 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37642_RS06035 (MGAS37642_02484) | - | 1185285..1185548 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37642_RS06040 (MGAS37642_02486) | - | 1185559..1186152 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37642_RS06045 (MGAS37642_02488) | - | 1186164..1186499 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37642_RS06050 (MGAS37642_02490) | - | 1186500..1186736 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37642_RS06055 (MGAS37642_02492) | - | 1186729..1187067 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37642_RS06060 (MGAS37642_02494) | - | 1187027..1187449 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37642_RS06065 (MGAS37642_02496) | - | 1187459..1187659 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37642_RS06070 (MGAS37642_02498) | - | 1187659..1188570 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37642_RS06075 (MGAS37642_02500) | - | 1188595..1189056 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37642_RS06080 (MGAS37642_02502) | - | 1189137..1190552 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37642_RS06085 (MGAS37642_02504) | - | 1190662..1190928 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37642_RS06090 (MGAS37642_02506) | - | 1190921..1191100 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37642_RS06095 (MGAS37642_02508) | - | 1191150..1191374 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37642_RS06100 (MGAS37642_02510) | - | 1191380..1192873 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37642_RS06105 (MGAS37642_02512) | - | 1192866..1194134 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37642_RS06110 (MGAS37642_02514) | - | 1194131..1194487 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37642_RS06115 | - | 1194636..1194980 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37642_RS06120 (MGAS37642_02516) | - | 1195089..1195508 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37642_RS06125 (MGAS37642_02518) | - | 1195776..1196411 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37642_RS06130 (MGAS37642_02520) | - | 1196413..1196682 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37642_RS06135 (MGAS37642_02522) | - | 1196766..1197278 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37642_RS06140 (MGAS37642_02524) | - | 1197275..1197616 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37642_RS06145 (MGAS37642_02526) | - | 1197794..1197961 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37642_RS06150 (MGAS37642_02528) | - | 1197971..1198768 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37642_RS06155 (MGAS37642_02530) | - | 1198765..1199694 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37642_RS06160 (MGAS37642_02532) | - | 1199697..1200026 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37642_RS06165 (MGAS37642_02534) | - | 1200082..1200288 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37642_RS06170 (MGAS37642_02536) | - | 1200297..1200437 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37642_RS06175 (MGAS37642_02538) | - | 1200434..1200667 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37642_RS06180 (MGAS37642_02540) | - | 1200648..1201037 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37642_RS06185 | - | 1201182..1201421 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37642_RS06190 (MGAS37642_02542) | - | 1201521..1201706 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37642_RS06195 (MGAS37642_02544) | - | 1201708..1202019 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37642_RS06200 (MGAS37642_02546) | - | 1202097..1202282 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37642_RS06205 (MGAS37642_02548) | - | 1202449..1202688 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37642_RS06210 (MGAS37642_02550) | - | 1202830..1203636 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37642_RS06215 (MGAS37642_02552) | - | 1203571..1203837 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37642_RS06220 (MGAS37642_02554) | - | 1203869..1204585 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37642_RS06225 (MGAS37642_02556) | - | 1204597..1204788 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37642_RS06230 | - | 1205424..1205519 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37642_RS06235 (MGAS37642_02560) | - | 1205942..1206289 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37642_RS06240 (MGAS37642_02562) | - | 1206293..1206673 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37642_RS06245 (MGAS37642_02564) | - | 1206685..1206951 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37642_RS06250 (MGAS37642_02566) | - | 1207075..1208217 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37642_RS06255 (MGAS37642_02568) | - | 1208307..1208582 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=978500 MGAS37642_RS05975 WP_011017964.1 1175096..1175278(-) (prx) [Streptococcus pyogenes strain MGAS37642]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=978500 MGAS37642_RS05975 WP_011017964.1 1175096..1175278(-) (prx) [Streptococcus pyogenes strain MGAS37642]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |