Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37644_RS07180 | Genome accession | NZ_CP151467 |
| Coordinates | 1408776..1408955 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS37644 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408776..1449392 | 1408776..1408955 | within | 0 |
Gene organization within MGE regions
Location: 1408776..1449392
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37644_RS07180 (MGAS37644_02946) | prx | 1408776..1408955 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS37644_RS07185 (MGAS37644_02948) | sda1 | 1409194..1410366 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS37644_RS07190 (MGAS37644_02950) | - | 1410482..1411678 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS37644_RS07195 (MGAS37644_02954) | - | 1411789..1411974 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS37644_RS07200 (MGAS37644_02956) | - | 1411971..1412270 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS37644_RS07205 (MGAS37644_02958) | - | 1412281..1412901 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS37644_RS07210 (MGAS37644_02960) | - | 1412904..1413065 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS37644_RS07215 (MGAS37644_02962) | - | 1413074..1414981 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS37644_RS07220 (MGAS37644_02964) | - | 1414992..1415627 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS37644_RS07225 (MGAS37644_02966) | - | 1415627..1416682 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS37644_RS07230 (MGAS37644_02968) | - | 1416679..1418661 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS37644_RS07235 (MGAS37644_02970) | - | 1418671..1419513 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS37644_RS07240 (MGAS37644_02972) | - | 1419525..1423907 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS37644_RS07245 (MGAS37644_02974) | - | 1423922..1424155 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS37644_RS07250 (MGAS37644_02976) | - | 1424230..1424685 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS37644_RS07255 (MGAS37644_02978) | - | 1424739..1425338 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS37644_RS07260 (MGAS37644_02980) | - | 1425350..1425709 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS37644_RS07265 (MGAS37644_02982) | - | 1425713..1426057 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS37644_RS07270 (MGAS37644_02984) | - | 1426054..1426332 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS37644_RS07275 (MGAS37644_02986) | - | 1426343..1426699 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS37644_RS07280 (MGAS37644_02988) | - | 1426711..1427598 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS37644_RS07285 (MGAS37644_02990) | - | 1427611..1428180 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS37644_RS07290 (MGAS37644_02992) | - | 1428336..1428602 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS37644_RS07295 | - | 1428605..1428793 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS37644_RS07300 (MGAS37644_02996) | - | 1428824..1430269 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS37644_RS07305 (MGAS37644_02998) | - | 1430229..1431761 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS37644_RS07310 (MGAS37644_03000) | - | 1431777..1433054 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS37644_RS07315 (MGAS37644_03002) | - | 1433044..1433496 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS37644_RS07320 (MGAS37644_03004) | - | 1433586..1434002 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS37644_RS07325 (MGAS37644_03006) | - | 1433999..1434190 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS37644_RS07330 (MGAS37644_03008) | - | 1434180..1435031 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS37644_RS07335 (MGAS37644_03010) | - | 1435040..1435306 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS37644_RS07340 (MGAS37644_03012) | - | 1435303..1435470 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS37644_RS07345 (MGAS37644_03014) | - | 1435471..1436793 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS37644_RS07350 (MGAS37644_03016) | - | 1436790..1437065 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS37644_RS07355 (MGAS37644_03018) | - | 1437452..1439836 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS37644_RS07360 (MGAS37644_03020) | - | 1439841..1441763 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS37644_RS07365 (MGAS37644_03022) | - | 1441806..1442363 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS37644_RS07370 (MGAS37644_03024) | - | 1442374..1442772 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS37644_RS07375 (MGAS37644_03026) | - | 1442776..1443930 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS37644_RS07380 (MGAS37644_03028) | - | 1443930..1444229 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS37644_RS07385 (MGAS37644_03030) | - | 1444317..1444520 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS37644_RS07390 (MGAS37644_03034) | - | 1444666..1445052 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS37644_RS07395 (MGAS37644_03036) | - | 1445049..1445252 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS37644_RS07400 (MGAS37644_03038) | - | 1445245..1445415 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS37644_RS07405 (MGAS37644_03040) | - | 1445412..1445687 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS37644_RS07410 (MGAS37644_03042) | - | 1445749..1445964 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS37644_RS07415 (MGAS37644_03044) | - | 1446012..1446425 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS37644_RS07420 (MGAS37644_03046) | - | 1446406..1446561 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS37644_RS07425 (MGAS37644_03048) | - | 1446887..1447237 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS37644_RS07430 (MGAS37644_03050) | - | 1447251..1447634 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37644_RS07435 (MGAS37644_03052) | - | 1447645..1448196 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS37644_RS07440 (MGAS37644_03054) | - | 1448313..1449392 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=978451 MGAS37644_RS07180 WP_002988813.1 1408776..1408955(-) (prx) [Streptococcus pyogenes strain MGAS37644]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=978451 MGAS37644_RS07180 WP_002988813.1 1408776..1408955(-) (prx) [Streptococcus pyogenes strain MGAS37644]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |