Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37644_RS05065 | Genome accession | NZ_CP151467 |
| Coordinates | 1007359..1007547 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37644 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999775..1046085 | 1007359..1007547 | within | 0 |
Gene organization within MGE regions
Location: 999775..1046085
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37644_RS05030 (MGAS37644_02076) | pfkA | 999775..1000788 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS37644_RS05035 (MGAS37644_02078) | - | 1000868..1003978 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS37644_RS05040 (MGAS37644_02080) | - | 1004163..1004534 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS37644_RS05045 (MGAS37644_02082) | - | 1004534..1005232 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS37644_RS05050 (MGAS37644_02084) | - | 1005242..1006027 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS37644_RS05055 (MGAS37644_02086) | - | 1006154..1006768 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS37644_RS05065 (MGAS37644_02090) | prx | 1007359..1007547 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS37644_RS05070 (MGAS37644_02092) | speA | 1007767..1008522 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS37644_RS05075 (MGAS37644_02094) | - | 1008644..1009303 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS37644_RS05080 (MGAS37644_02096) | - | 1009303..1009524 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS37644_RS05085 (MGAS37644_02098) | - | 1009534..1010307 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS37644_RS05090 (MGAS37644_02100) | - | 1010318..1010920 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS37644_RS05095 (MGAS37644_02102) | - | 1010932..1011696 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS37644_RS05100 (MGAS37644_02104) | - | 1011698..1012030 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS37644_RS05105 (MGAS37644_02106) | - | 1012030..1012353 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS37644_RS05110 (MGAS37644_02108) | - | 1012367..1012489 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS37644_RS05115 (MGAS37644_02110) | - | 1012503..1012850 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS37644_RS05120 (MGAS37644_02112) | - | 1012861..1014723 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS37644_RS05125 (MGAS37644_02114) | - | 1014728..1018168 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS37644_RS05130 (MGAS37644_02116) | - | 1018169..1019653 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS37644_RS05135 (MGAS37644_02118) | - | 1019654..1021459 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS37644_RS05140 (MGAS37644_02120) | - | 1021452..1021910 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS37644_RS05145 (MGAS37644_02122) | - | 1021883..1022200 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS37644_RS05150 (MGAS37644_02124) | - | 1022213..1022719 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS37644_RS05155 (MGAS37644_02126) | - | 1022731..1023141 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS37644_RS05160 (MGAS37644_02128) | - | 1023143..1023538 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS37644_RS05165 (MGAS37644_02130) | - | 1023535..1023846 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS37644_RS05170 (MGAS37644_02132) | - | 1023843..1024187 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS37644_RS05175 (MGAS37644_02134) | - | 1024201..1024494 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS37644_RS05180 (MGAS37644_02136) | - | 1024507..1025397 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS37644_RS05185 (MGAS37644_02138) | - | 1025416..1025985 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS37644_RS05190 (MGAS37644_02140) | - | 1026094..1026228 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS37644_RS05195 (MGAS37644_02142) | - | 1026230..1026499 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS37644_RS05200 (MGAS37644_02144) | - | 1026506..1027414 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS37644_RS05205 (MGAS37644_02146) | - | 1027383..1028708 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS37644_RS05210 (MGAS37644_02148) | - | 1028708..1029982 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS37644_RS05215 (MGAS37644_02150) | - | 1029972..1030352 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS37644_RS05220 (MGAS37644_02152) | - | 1030962..1031396 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS37644_RS05225 (MGAS37644_02154) | - | 1031682..1031948 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS37644_RS05230 (MGAS37644_02156) | - | 1031945..1032469 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS37644_RS05235 (MGAS37644_02158) | - | 1032472..1033104 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS37644_RS05240 (MGAS37644_02160) | - | 1033106..1033390 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS37644_RS05245 (MGAS37644_02162) | - | 1033387..1033557 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS37644_RS05250 (MGAS37644_02164) | - | 1033554..1033790 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS37644_RS05255 (MGAS37644_02166) | - | 1033790..1034035 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS37644_RS05260 (MGAS37644_02168) | - | 1034032..1034388 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS37644_RS05265 (MGAS37644_02170) | - | 1034385..1034825 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS37644_RS05270 | - | 1034825..1035028 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS37644_RS05275 (MGAS37644_02172) | ssb | 1035034..1035459 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS37644_RS05280 (MGAS37644_02174) | - | 1035452..1036126 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS37644_RS05285 (MGAS37644_02176) | - | 1036127..1036609 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS37644_RS05290 (MGAS37644_02178) | - | 1036631..1036885 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS37644_RS05295 (MGAS37644_02180) | - | 1036866..1037219 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS37644_RS05300 (MGAS37644_02184) | - | 1037360..1038142 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS37644_RS05305 (MGAS37644_02186) | - | 1038129..1038959 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS37644_RS05310 | - | 1038973..1039161 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| MGAS37644_RS05315 | - | 1039395..1039634 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS37644_RS05320 (MGAS37644_02190) | - | 1039765..1039974 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS37644_RS05325 (MGAS37644_02192) | - | 1040084..1040284 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS37644_RS05330 (MGAS37644_02194) | - | 1040358..1040744 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS37644_RS05335 (MGAS37644_02196) | - | 1040733..1040942 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS37644_RS05340 (MGAS37644_02198) | - | 1040996..1041595 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS37644_RS05345 (MGAS37644_02200) | - | 1041625..1041783 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS37644_RS05350 (MGAS37644_02204) | - | 1042140..1042964 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37644_RS05355 (MGAS37644_02206) | - | 1043000..1043893 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS37644_RS05360 | - | 1044014..1045102 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS37644_RS05365 (MGAS37644_02212) | - | 1045465..1046085 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=978440 MGAS37644_RS05065 WP_011285559.1 1007359..1007547(-) (prx) [Streptococcus pyogenes strain MGAS37644]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=978440 MGAS37644_RS05065 WP_011285559.1 1007359..1007547(-) (prx) [Streptococcus pyogenes strain MGAS37644]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |