Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37823_RS05065 | Genome accession | NZ_CP151463 |
| Coordinates | 1007355..1007543 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37823 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999771..1046081 | 1007355..1007543 | within | 0 |
Gene organization within MGE regions
Location: 999771..1046081
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37823_RS05030 (MGAS37823_02074) | pfkA | 999771..1000784 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS37823_RS05035 (MGAS37823_02076) | - | 1000864..1003974 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS37823_RS05040 (MGAS37823_02078) | - | 1004159..1004530 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS37823_RS05045 (MGAS37823_02080) | - | 1004530..1005228 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS37823_RS05050 (MGAS37823_02082) | - | 1005238..1006023 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS37823_RS05055 (MGAS37823_02084) | - | 1006150..1006764 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS37823_RS05065 (MGAS37823_02088) | prx | 1007355..1007543 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS37823_RS05070 (MGAS37823_02090) | speA | 1007763..1008518 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS37823_RS05075 (MGAS37823_02092) | - | 1008640..1009299 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS37823_RS05080 (MGAS37823_02094) | - | 1009299..1009520 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS37823_RS05085 (MGAS37823_02096) | - | 1009530..1010303 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS37823_RS05090 (MGAS37823_02098) | - | 1010314..1010916 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS37823_RS05095 (MGAS37823_02100) | - | 1010928..1011692 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS37823_RS05100 (MGAS37823_02102) | - | 1011694..1012026 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS37823_RS05105 (MGAS37823_02104) | - | 1012026..1012349 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS37823_RS05110 (MGAS37823_02106) | - | 1012363..1012485 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS37823_RS05115 (MGAS37823_02108) | - | 1012499..1012846 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS37823_RS05120 (MGAS37823_02110) | - | 1012857..1014719 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS37823_RS05125 (MGAS37823_02112) | - | 1014724..1018164 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS37823_RS05130 (MGAS37823_02114) | - | 1018165..1019649 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS37823_RS05135 (MGAS37823_02116) | - | 1019650..1021455 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS37823_RS05140 (MGAS37823_02118) | - | 1021448..1021906 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS37823_RS05145 (MGAS37823_02120) | - | 1021879..1022196 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS37823_RS05150 (MGAS37823_02122) | - | 1022209..1022715 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS37823_RS05155 (MGAS37823_02124) | - | 1022727..1023137 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS37823_RS05160 (MGAS37823_02126) | - | 1023139..1023534 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS37823_RS05165 (MGAS37823_02128) | - | 1023531..1023842 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS37823_RS05170 (MGAS37823_02130) | - | 1023839..1024183 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS37823_RS05175 (MGAS37823_02132) | - | 1024197..1024490 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS37823_RS05180 (MGAS37823_02134) | - | 1024503..1025393 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS37823_RS05185 (MGAS37823_02136) | - | 1025412..1025981 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS37823_RS05190 (MGAS37823_02138) | - | 1026090..1026224 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS37823_RS05195 (MGAS37823_02140) | - | 1026226..1026495 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS37823_RS05200 (MGAS37823_02142) | - | 1026502..1027410 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS37823_RS05205 (MGAS37823_02144) | - | 1027379..1028704 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS37823_RS05210 (MGAS37823_02146) | - | 1028704..1029978 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS37823_RS05215 (MGAS37823_02148) | - | 1029968..1030348 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS37823_RS05220 (MGAS37823_02150) | - | 1030958..1031392 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS37823_RS05225 (MGAS37823_02152) | - | 1031678..1031944 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS37823_RS05230 (MGAS37823_02154) | - | 1031941..1032465 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS37823_RS05235 (MGAS37823_02156) | - | 1032468..1033100 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS37823_RS05240 (MGAS37823_02158) | - | 1033102..1033386 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS37823_RS05245 (MGAS37823_02160) | - | 1033383..1033553 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS37823_RS05250 (MGAS37823_02162) | - | 1033550..1033786 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS37823_RS05255 (MGAS37823_02164) | - | 1033786..1034031 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS37823_RS05260 (MGAS37823_02166) | - | 1034028..1034384 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS37823_RS05265 (MGAS37823_02168) | - | 1034381..1034821 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS37823_RS05270 | - | 1034821..1035024 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS37823_RS05275 (MGAS37823_02170) | ssb | 1035030..1035455 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS37823_RS05280 (MGAS37823_02172) | - | 1035448..1036122 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS37823_RS05285 (MGAS37823_02174) | - | 1036123..1036605 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS37823_RS05290 (MGAS37823_02176) | - | 1036627..1036881 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS37823_RS05295 (MGAS37823_02178) | - | 1036862..1037215 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS37823_RS05300 (MGAS37823_02182) | - | 1037356..1038138 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS37823_RS05305 (MGAS37823_02184) | - | 1038125..1038955 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS37823_RS05310 | - | 1038969..1039157 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| MGAS37823_RS05315 | - | 1039391..1039630 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS37823_RS05320 (MGAS37823_02188) | - | 1039761..1039970 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS37823_RS05325 (MGAS37823_02190) | - | 1040080..1040280 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS37823_RS05330 (MGAS37823_02192) | - | 1040354..1040740 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS37823_RS05335 (MGAS37823_02194) | - | 1040729..1040938 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS37823_RS05340 (MGAS37823_02196) | - | 1040992..1041591 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS37823_RS05345 (MGAS37823_02198) | - | 1041621..1041779 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS37823_RS05350 (MGAS37823_02202) | - | 1042136..1042960 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37823_RS05355 (MGAS37823_02204) | - | 1042996..1043889 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS37823_RS05360 | - | 1044010..1045098 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS37823_RS05365 (MGAS37823_02210) | - | 1045461..1046081 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=978216 MGAS37823_RS05065 WP_011285559.1 1007355..1007543(-) (prx) [Streptococcus pyogenes strain MGAS37823]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=978216 MGAS37823_RS05065 WP_011285559.1 1007355..1007543(-) (prx) [Streptococcus pyogenes strain MGAS37823]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |