Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37826_RS05910 | Genome accession | NZ_CP151462 |
| Coordinates | 1169093..1169275 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37826 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169093..1204103 | 1169093..1169275 | within | 0 |
Gene organization within MGE regions
Location: 1169093..1204103
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37826_RS05910 (MGAS37826_02436) | prx | 1169093..1169275 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37826_RS05915 (MGAS37826_02438) | sda3 | 1169514..1170314 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37826_RS05920 (MGAS37826_02440) | - | 1170585..1171019 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37826_RS05925 (MGAS37826_02442) | - | 1171089..1172294 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37826_RS05930 (MGAS37826_02444) | - | 1172410..1172637 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37826_RS05935 (MGAS37826_02446) | - | 1172634..1172909 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37826_RS05940 (MGAS37826_02448) | - | 1172919..1173536 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37826_RS05945 (MGAS37826_02450) | - | 1173533..1173970 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37826_RS05950 (MGAS37826_02452) | - | 1173982..1175850 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37826_RS05955 (MGAS37826_02454) | - | 1175847..1176542 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37826_RS05960 (MGAS37826_02456) | - | 1176539..1178896 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37826_RS05965 (MGAS37826_02458) | - | 1178896..1179267 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37826_RS05970 (MGAS37826_02460) | - | 1179282..1179545 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37826_RS05975 (MGAS37826_02462) | - | 1179556..1180149 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37826_RS05980 (MGAS37826_02464) | - | 1180161..1180496 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37826_RS05985 (MGAS37826_02466) | - | 1180497..1180733 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37826_RS05990 (MGAS37826_02468) | - | 1180726..1181064 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37826_RS05995 (MGAS37826_02470) | - | 1181024..1181446 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37826_RS06000 (MGAS37826_02472) | - | 1181456..1181656 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37826_RS06005 (MGAS37826_02474) | - | 1181656..1182567 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37826_RS06010 (MGAS37826_02476) | - | 1182592..1183053 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37826_RS06015 (MGAS37826_02478) | - | 1183134..1184549 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37826_RS06020 (MGAS37826_02480) | - | 1184659..1184925 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37826_RS06025 (MGAS37826_02482) | - | 1184918..1185097 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37826_RS06030 (MGAS37826_02484) | - | 1185147..1185371 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37826_RS06035 (MGAS37826_02486) | - | 1185377..1186870 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37826_RS06040 (MGAS37826_02488) | - | 1186863..1188131 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37826_RS06045 (MGAS37826_02490) | - | 1188128..1188484 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37826_RS06050 | - | 1188633..1188977 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37826_RS06055 (MGAS37826_02492) | - | 1189086..1189505 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37826_RS06060 (MGAS37826_02494) | - | 1189773..1190408 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37826_RS06065 (MGAS37826_02496) | - | 1190410..1190679 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37826_RS06070 (MGAS37826_02498) | - | 1190763..1191275 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37826_RS06075 (MGAS37826_02500) | - | 1191272..1191613 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37826_RS06080 (MGAS37826_02502) | - | 1191791..1191958 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37826_RS06085 (MGAS37826_02504) | - | 1191968..1192765 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37826_RS06090 (MGAS37826_02506) | - | 1192762..1193691 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37826_RS06095 (MGAS37826_02508) | - | 1193694..1194023 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37826_RS06100 (MGAS37826_02510) | - | 1194079..1194285 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37826_RS06105 (MGAS37826_02512) | - | 1194294..1194434 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37826_RS06110 (MGAS37826_02514) | - | 1194431..1194664 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37826_RS06115 (MGAS37826_02516) | - | 1194645..1195034 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37826_RS06120 | - | 1195179..1195418 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37826_RS06125 (MGAS37826_02518) | - | 1195518..1195703 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37826_RS06130 (MGAS37826_02520) | - | 1195705..1196016 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37826_RS06135 (MGAS37826_02522) | - | 1196094..1196279 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37826_RS06140 (MGAS37826_02524) | - | 1196446..1196685 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37826_RS06145 (MGAS37826_02526) | - | 1196827..1197633 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37826_RS06150 (MGAS37826_02528) | - | 1197568..1197834 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37826_RS06155 (MGAS37826_02530) | - | 1197866..1198582 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37826_RS06160 (MGAS37826_02532) | - | 1198594..1198785 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37826_RS06165 | - | 1199421..1199516 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37826_RS06170 (MGAS37826_02536) | - | 1199939..1200286 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37826_RS06175 (MGAS37826_02538) | - | 1200290..1200670 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37826_RS06180 (MGAS37826_02540) | - | 1200682..1200948 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37826_RS06185 (MGAS37826_02542) | - | 1201072..1202214 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37826_RS06190 (MGAS37826_02544) | - | 1202304..1202579 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37826_RS06195 (MGAS37826_02546) | - | 1202678..1203265 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37826_RS06200 (MGAS37826_02548) | - | 1203243..1204085 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=978164 MGAS37826_RS05910 WP_011017964.1 1169093..1169275(-) (prx) [Streptococcus pyogenes strain MGAS37826]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=978164 MGAS37826_RS05910 WP_011017964.1 1169093..1169275(-) (prx) [Streptococcus pyogenes strain MGAS37826]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |