Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37828_RS05910 | Genome accession | NZ_CP151461 |
| Coordinates | 1169092..1169274 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37828 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169092..1204102 | 1169092..1169274 | within | 0 |
Gene organization within MGE regions
Location: 1169092..1204102
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37828_RS05910 (MGAS37828_02434) | prx | 1169092..1169274 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37828_RS05915 (MGAS37828_02436) | sda3 | 1169513..1170313 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37828_RS05920 (MGAS37828_02438) | - | 1170584..1171018 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37828_RS05925 (MGAS37828_02440) | - | 1171088..1172293 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37828_RS05930 (MGAS37828_02442) | - | 1172409..1172636 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37828_RS05935 (MGAS37828_02444) | - | 1172633..1172908 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37828_RS05940 (MGAS37828_02446) | - | 1172918..1173535 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37828_RS05945 (MGAS37828_02448) | - | 1173532..1173969 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37828_RS05950 (MGAS37828_02450) | - | 1173981..1175849 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37828_RS05955 (MGAS37828_02452) | - | 1175846..1176541 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37828_RS05960 (MGAS37828_02454) | - | 1176538..1178895 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37828_RS05965 (MGAS37828_02456) | - | 1178895..1179266 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37828_RS05970 (MGAS37828_02458) | - | 1179281..1179544 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37828_RS05975 (MGAS37828_02460) | - | 1179555..1180148 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37828_RS05980 (MGAS37828_02462) | - | 1180160..1180495 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37828_RS05985 (MGAS37828_02464) | - | 1180496..1180732 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37828_RS05990 (MGAS37828_02466) | - | 1180725..1181063 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37828_RS05995 (MGAS37828_02468) | - | 1181023..1181445 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37828_RS06000 (MGAS37828_02470) | - | 1181455..1181655 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37828_RS06005 (MGAS37828_02472) | - | 1181655..1182566 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37828_RS06010 (MGAS37828_02474) | - | 1182591..1183052 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37828_RS06015 (MGAS37828_02476) | - | 1183133..1184548 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37828_RS06020 (MGAS37828_02478) | - | 1184658..1184924 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37828_RS06025 (MGAS37828_02480) | - | 1184917..1185096 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37828_RS06030 (MGAS37828_02482) | - | 1185146..1185370 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37828_RS06035 (MGAS37828_02484) | - | 1185376..1186869 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37828_RS06040 (MGAS37828_02486) | - | 1186862..1188130 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37828_RS06045 (MGAS37828_02488) | - | 1188127..1188483 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37828_RS06050 | - | 1188632..1188976 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37828_RS06055 (MGAS37828_02490) | - | 1189085..1189504 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37828_RS06060 (MGAS37828_02492) | - | 1189772..1190407 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37828_RS06065 (MGAS37828_02494) | - | 1190409..1190678 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37828_RS06070 (MGAS37828_02496) | - | 1190762..1191274 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37828_RS06075 (MGAS37828_02498) | - | 1191271..1191612 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37828_RS06080 (MGAS37828_02500) | - | 1191790..1191957 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37828_RS06085 (MGAS37828_02502) | - | 1191967..1192764 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37828_RS06090 (MGAS37828_02504) | - | 1192761..1193690 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37828_RS06095 (MGAS37828_02506) | - | 1193693..1194022 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37828_RS06100 (MGAS37828_02508) | - | 1194078..1194284 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37828_RS06105 (MGAS37828_02510) | - | 1194293..1194433 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37828_RS06110 (MGAS37828_02512) | - | 1194430..1194663 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37828_RS06115 (MGAS37828_02514) | - | 1194644..1195033 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37828_RS06120 | - | 1195178..1195417 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37828_RS06125 (MGAS37828_02516) | - | 1195517..1195702 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37828_RS06130 (MGAS37828_02518) | - | 1195704..1196015 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37828_RS06135 (MGAS37828_02520) | - | 1196093..1196278 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37828_RS06140 (MGAS37828_02522) | - | 1196445..1196684 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37828_RS06145 (MGAS37828_02524) | - | 1196826..1197632 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37828_RS06150 (MGAS37828_02526) | - | 1197567..1197833 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37828_RS06155 (MGAS37828_02528) | - | 1197865..1198581 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37828_RS06160 (MGAS37828_02530) | - | 1198593..1198784 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37828_RS06165 | - | 1199420..1199515 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37828_RS06170 (MGAS37828_02534) | - | 1199938..1200285 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37828_RS06175 (MGAS37828_02536) | - | 1200289..1200669 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37828_RS06180 (MGAS37828_02538) | - | 1200681..1200947 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37828_RS06185 (MGAS37828_02540) | - | 1201071..1202213 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37828_RS06190 (MGAS37828_02542) | - | 1202303..1202578 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37828_RS06195 (MGAS37828_02544) | - | 1202677..1203264 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37828_RS06200 (MGAS37828_02546) | - | 1203242..1204084 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=978109 MGAS37828_RS05910 WP_011017964.1 1169092..1169274(-) (prx) [Streptococcus pyogenes strain MGAS37828]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=978109 MGAS37828_RS05910 WP_011017964.1 1169092..1169274(-) (prx) [Streptococcus pyogenes strain MGAS37828]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |