Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37832_RS07205 | Genome accession | NZ_CP151458 |
| Coordinates | 1413032..1413211 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS37832 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1405150..1453649 | 1413032..1413211 | within | 0 |
Gene organization within MGE regions
Location: 1405150..1453649
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37832_RS07165 (MGAS37832_02942) | - | 1405150..1405584 (-) | 435 | WP_010922579.1 | CopY/TcrY family copper transport repressor | - |
| MGAS37832_RS07170 (MGAS37832_02944) | - | 1405768..1406742 (+) | 975 | WP_227869327.1 | alpha/beta hydrolase fold domain-containing protein | - |
| MGAS37832_RS07175 (MGAS37832_02946) | rbfA | 1406876..1407226 (-) | 351 | WP_002994317.1 | 30S ribosome-binding factor RbfA | - |
| MGAS37832_RS07180 (MGAS37832_02948) | infB | 1407431..1410292 (-) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| MGAS37832_RS07185 (MGAS37832_02950) | - | 1410312..1410614 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| MGAS37832_RS07190 (MGAS37832_02952) | rnpM | 1410607..1410903 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| MGAS37832_RS07195 (MGAS37832_02954) | nusA | 1410919..1412076 (-) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| MGAS37832_RS07200 (MGAS37832_02956) | rimP | 1412251..1412787 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| MGAS37832_RS07205 (MGAS37832_02958) | prx | 1413032..1413211 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS37832_RS07210 (MGAS37832_02960) | sda1 | 1413450..1414622 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS37832_RS07215 (MGAS37832_02962) | - | 1414738..1415934 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS37832_RS07220 (MGAS37832_02966) | - | 1416045..1416230 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS37832_RS07225 (MGAS37832_02968) | - | 1416227..1416526 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS37832_RS07230 (MGAS37832_02970) | - | 1416537..1417157 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS37832_RS07235 (MGAS37832_02972) | - | 1417160..1417321 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS37832_RS07240 (MGAS37832_02974) | - | 1417330..1419237 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS37832_RS07245 (MGAS37832_02976) | - | 1419248..1419883 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS37832_RS07250 (MGAS37832_02978) | - | 1419883..1420938 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS37832_RS07255 (MGAS37832_02980) | - | 1420935..1422917 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS37832_RS07260 (MGAS37832_02982) | - | 1422927..1423769 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS37832_RS07265 (MGAS37832_02984) | - | 1423781..1428163 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS37832_RS07270 (MGAS37832_02986) | - | 1428178..1428411 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS37832_RS07275 (MGAS37832_02988) | - | 1428486..1428941 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS37832_RS07280 (MGAS37832_02990) | - | 1428995..1429594 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS37832_RS07285 (MGAS37832_02992) | - | 1429606..1429965 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS37832_RS07290 (MGAS37832_02994) | - | 1429969..1430313 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS37832_RS07295 (MGAS37832_02996) | - | 1430310..1430588 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS37832_RS07300 (MGAS37832_02998) | - | 1430599..1430955 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS37832_RS07305 (MGAS37832_03000) | - | 1430967..1431854 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS37832_RS07310 (MGAS37832_03002) | - | 1431867..1432436 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS37832_RS07315 (MGAS37832_03004) | - | 1432592..1432858 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS37832_RS07320 | - | 1432861..1433049 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS37832_RS07325 (MGAS37832_03008) | - | 1433080..1434525 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS37832_RS07330 (MGAS37832_03010) | - | 1434485..1436017 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| MGAS37832_RS07335 (MGAS37832_03012) | - | 1436033..1437310 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS37832_RS07340 (MGAS37832_03014) | - | 1437300..1437752 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS37832_RS07345 (MGAS37832_03016) | - | 1437842..1438258 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS37832_RS07350 (MGAS37832_03018) | - | 1438255..1438446 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS37832_RS07355 (MGAS37832_03020) | - | 1438578..1439288 (-) | 711 | WP_050428439.1 | site-specific DNA-methyltransferase | - |
| MGAS37832_RS07360 (MGAS37832_03022) | - | 1439297..1439563 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS37832_RS07365 (MGAS37832_03024) | - | 1439560..1439727 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS37832_RS07370 (MGAS37832_03026) | - | 1439728..1441050 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS37832_RS07375 (MGAS37832_03028) | - | 1441047..1441322 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS37832_RS07380 (MGAS37832_03030) | - | 1441709..1444093 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS37832_RS07385 (MGAS37832_03032) | - | 1444098..1446020 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS37832_RS07390 (MGAS37832_03034) | - | 1446063..1446620 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS37832_RS07395 (MGAS37832_03036) | - | 1446631..1447029 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS37832_RS07400 (MGAS37832_03038) | - | 1447033..1448187 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS37832_RS07405 (MGAS37832_03040) | - | 1448187..1448486 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS37832_RS07410 (MGAS37832_03042) | - | 1448574..1448777 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS37832_RS07415 (MGAS37832_03046) | - | 1448923..1449309 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS37832_RS07420 (MGAS37832_03048) | - | 1449306..1449509 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS37832_RS07425 (MGAS37832_03050) | - | 1449502..1449672 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS37832_RS07430 (MGAS37832_03052) | - | 1449669..1449944 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS37832_RS07435 (MGAS37832_03054) | - | 1450006..1450221 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS37832_RS07440 (MGAS37832_03056) | - | 1450269..1450682 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS37832_RS07445 (MGAS37832_03058) | - | 1450663..1450818 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS37832_RS07450 (MGAS37832_03060) | - | 1451144..1451494 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS37832_RS07455 (MGAS37832_03062) | - | 1451508..1451891 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37832_RS07460 (MGAS37832_03064) | - | 1451902..1452453 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS37832_RS07465 (MGAS37832_03066) | - | 1452570..1453649 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=977948 MGAS37832_RS07205 WP_002988813.1 1413032..1413211(-) (prx) [Streptococcus pyogenes strain MGAS37832]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=977948 MGAS37832_RS07205 WP_002988813.1 1413032..1413211(-) (prx) [Streptococcus pyogenes strain MGAS37832]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |