Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37832_RS05940 | Genome accession | NZ_CP151458 |
| Coordinates | 1173354..1173536 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37832 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173354..1206841 | 1173354..1173536 | within | 0 |
Gene organization within MGE regions
Location: 1173354..1206841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37832_RS05940 (MGAS37832_02446) | prx | 1173354..1173536 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37832_RS05945 (MGAS37832_02448) | sda3 | 1173775..1174575 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37832_RS05950 (MGAS37832_02452) | - | 1175351..1176556 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37832_RS05955 (MGAS37832_02454) | - | 1176672..1176899 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37832_RS05960 (MGAS37832_02456) | - | 1176896..1177171 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37832_RS05965 (MGAS37832_02458) | - | 1177181..1177798 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37832_RS05970 (MGAS37832_02460) | - | 1177795..1178232 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37832_RS05975 (MGAS37832_02462) | - | 1178244..1180112 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37832_RS05980 (MGAS37832_02464) | - | 1180109..1180804 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37832_RS05985 (MGAS37832_02466) | - | 1180801..1183158 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37832_RS05990 (MGAS37832_02468) | - | 1183158..1183529 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37832_RS05995 (MGAS37832_02470) | - | 1183544..1183807 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37832_RS06000 (MGAS37832_02472) | - | 1183818..1184411 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37832_RS06005 (MGAS37832_02474) | - | 1184423..1184758 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37832_RS06010 (MGAS37832_02476) | - | 1184759..1184995 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37832_RS06015 (MGAS37832_02478) | - | 1184988..1185326 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37832_RS06020 (MGAS37832_02480) | - | 1185286..1185708 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37832_RS06025 (MGAS37832_02482) | - | 1185718..1185918 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37832_RS06030 (MGAS37832_02484) | - | 1185918..1186829 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37832_RS06035 (MGAS37832_02486) | - | 1186854..1187315 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37832_RS06040 (MGAS37832_02488) | - | 1187396..1188811 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37832_RS06045 (MGAS37832_02490) | - | 1188921..1189187 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37832_RS06050 (MGAS37832_02492) | - | 1189180..1189359 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37832_RS06055 (MGAS37832_02494) | - | 1189409..1189633 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37832_RS06060 (MGAS37832_02496) | - | 1189639..1191132 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37832_RS06065 (MGAS37832_02498) | - | 1191125..1192393 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37832_RS06070 (MGAS37832_02500) | - | 1192390..1192746 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37832_RS06075 | - | 1192895..1193239 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37832_RS06080 (MGAS37832_02502) | - | 1193348..1193767 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37832_RS06085 (MGAS37832_02504) | - | 1194035..1194670 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37832_RS06090 (MGAS37832_02506) | - | 1194672..1194941 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37832_RS06095 (MGAS37832_02508) | - | 1195025..1195537 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37832_RS06100 (MGAS37832_02510) | - | 1195534..1195875 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37832_RS06105 (MGAS37832_02512) | - | 1196053..1196220 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37832_RS06110 (MGAS37832_02514) | - | 1196230..1197027 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37832_RS06115 (MGAS37832_02516) | - | 1197024..1197953 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37832_RS06120 (MGAS37832_02518) | - | 1197956..1198285 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37832_RS06125 (MGAS37832_02520) | - | 1198341..1198547 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37832_RS06130 (MGAS37832_02522) | - | 1198556..1198696 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37832_RS06135 (MGAS37832_02524) | - | 1198693..1198926 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37832_RS06140 (MGAS37832_02526) | - | 1198907..1199296 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37832_RS06145 (MGAS37832_02528) | - | 1199441..1199680 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37832_RS06150 (MGAS37832_02530) | - | 1199780..1199965 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37832_RS06155 (MGAS37832_02532) | - | 1199967..1200278 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37832_RS06160 (MGAS37832_02534) | - | 1200356..1200541 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37832_RS06165 (MGAS37832_02536) | - | 1200708..1200947 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37832_RS06170 (MGAS37832_02538) | - | 1201089..1201895 (+) | 807 | Protein_1166 | TIGR02391 family protein | - |
| MGAS37832_RS06175 (MGAS37832_02540) | - | 1201830..1202096 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37832_RS06180 (MGAS37832_02542) | - | 1202128..1202844 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37832_RS06185 (MGAS37832_02544) | - | 1202856..1203047 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37832_RS06190 | - | 1203683..1203778 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37832_RS06195 (MGAS37832_02548) | - | 1204201..1204548 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37832_RS06200 (MGAS37832_02550) | - | 1204552..1204932 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37832_RS06205 (MGAS37832_02552) | - | 1204944..1205210 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37832_RS06210 (MGAS37832_02554) | - | 1205334..1206476 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37832_RS06215 (MGAS37832_02556) | - | 1206566..1206841 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977941 MGAS37832_RS05940 WP_011017964.1 1173354..1173536(-) (prx) [Streptococcus pyogenes strain MGAS37832]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977941 MGAS37832_RS05940 WP_011017964.1 1173354..1173536(-) (prx) [Streptococcus pyogenes strain MGAS37832]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |