Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37836_RS05925 | Genome accession | NZ_CP151455 |
| Coordinates | 1169310..1169492 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37836 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169310..1204320 | 1169310..1169492 | within | 0 |
Gene organization within MGE regions
Location: 1169310..1204320
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37836_RS05925 (MGAS37836_02438) | prx | 1169310..1169492 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS37836_RS05930 (MGAS37836_02440) | sda3 | 1169731..1170531 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS37836_RS05935 (MGAS37836_02442) | - | 1170802..1171236 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS37836_RS05940 (MGAS37836_02444) | - | 1171306..1172511 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS37836_RS05945 (MGAS37836_02446) | - | 1172627..1172854 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS37836_RS05950 (MGAS37836_02448) | - | 1172851..1173126 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS37836_RS05955 (MGAS37836_02450) | - | 1173136..1173753 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS37836_RS05960 (MGAS37836_02452) | - | 1173750..1174187 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS37836_RS05965 (MGAS37836_02454) | - | 1174199..1176067 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS37836_RS05970 (MGAS37836_02456) | - | 1176064..1176759 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS37836_RS05975 (MGAS37836_02458) | - | 1176756..1179113 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS37836_RS05980 (MGAS37836_02460) | - | 1179113..1179484 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS37836_RS05985 (MGAS37836_02462) | - | 1179499..1179762 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS37836_RS05990 (MGAS37836_02464) | - | 1179773..1180366 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS37836_RS05995 (MGAS37836_02466) | - | 1180378..1180713 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS37836_RS06000 (MGAS37836_02468) | - | 1180714..1180950 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS37836_RS06005 (MGAS37836_02470) | - | 1180943..1181281 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS37836_RS06010 (MGAS37836_02472) | - | 1181241..1181663 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS37836_RS06015 (MGAS37836_02474) | - | 1181673..1181873 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS37836_RS06020 (MGAS37836_02476) | - | 1181873..1182784 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS37836_RS06025 (MGAS37836_02478) | - | 1182809..1183270 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS37836_RS06030 (MGAS37836_02480) | - | 1183351..1184766 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS37836_RS06035 (MGAS37836_02482) | - | 1184876..1185142 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS37836_RS06040 (MGAS37836_02484) | - | 1185135..1185314 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS37836_RS06045 (MGAS37836_02486) | - | 1185364..1185588 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS37836_RS06050 (MGAS37836_02488) | - | 1185594..1187087 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS37836_RS06055 (MGAS37836_02490) | - | 1187080..1188348 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS37836_RS06060 (MGAS37836_02492) | - | 1188345..1188701 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS37836_RS06065 | - | 1188850..1189194 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS37836_RS06070 (MGAS37836_02494) | - | 1189303..1189722 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS37836_RS06075 (MGAS37836_02496) | - | 1189990..1190625 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS37836_RS06080 (MGAS37836_02498) | - | 1190627..1190896 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS37836_RS06085 (MGAS37836_02500) | - | 1190980..1191492 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS37836_RS06090 (MGAS37836_02502) | - | 1191489..1191830 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS37836_RS06095 (MGAS37836_02504) | - | 1192008..1192175 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS37836_RS06100 (MGAS37836_02506) | - | 1192185..1192982 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS37836_RS06105 (MGAS37836_02508) | - | 1192979..1193908 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS37836_RS06110 (MGAS37836_02510) | - | 1193911..1194240 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS37836_RS06115 (MGAS37836_02512) | - | 1194296..1194502 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS37836_RS06120 (MGAS37836_02514) | - | 1194511..1194651 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS37836_RS06125 (MGAS37836_02516) | - | 1194648..1194881 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS37836_RS06130 (MGAS37836_02518) | - | 1194862..1195251 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| MGAS37836_RS06135 (MGAS37836_02520) | - | 1195396..1195635 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS37836_RS06140 (MGAS37836_02522) | - | 1195735..1195920 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS37836_RS06145 (MGAS37836_02524) | - | 1195922..1196233 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS37836_RS06150 (MGAS37836_02526) | - | 1196311..1196496 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37836_RS06155 (MGAS37836_02528) | - | 1196663..1196902 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS37836_RS06160 (MGAS37836_02530) | - | 1197044..1197850 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS37836_RS06165 (MGAS37836_02532) | - | 1197785..1198051 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS37836_RS06170 (MGAS37836_02534) | - | 1198083..1198799 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS37836_RS06175 (MGAS37836_02536) | - | 1198811..1199002 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS37836_RS06180 | - | 1199638..1199733 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS37836_RS06185 (MGAS37836_02540) | - | 1200156..1200503 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| MGAS37836_RS06190 (MGAS37836_02542) | - | 1200507..1200887 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37836_RS06195 (MGAS37836_02544) | - | 1200899..1201165 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS37836_RS06200 (MGAS37836_02546) | - | 1201289..1202431 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS37836_RS06205 (MGAS37836_02548) | - | 1202521..1202796 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS37836_RS06210 (MGAS37836_02550) | - | 1202895..1203482 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS37836_RS06215 (MGAS37836_02552) | - | 1203460..1204302 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=977773 MGAS37836_RS05925 WP_011017964.1 1169310..1169492(-) (prx) [Streptococcus pyogenes strain MGAS37836]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=977773 MGAS37836_RS05925 WP_011017964.1 1169310..1169492(-) (prx) [Streptococcus pyogenes strain MGAS37836]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |