Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37836_RS05080 | Genome accession | NZ_CP151455 |
| Coordinates | 1007569..1007757 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37836 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999985..1046295 | 1007569..1007757 | within | 0 |
Gene organization within MGE regions
Location: 999985..1046295
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37836_RS05045 (MGAS37836_02078) | pfkA | 999985..1000998 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS37836_RS05050 (MGAS37836_02080) | - | 1001078..1004188 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS37836_RS05055 (MGAS37836_02082) | - | 1004373..1004744 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS37836_RS05060 (MGAS37836_02084) | - | 1004744..1005442 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS37836_RS05065 (MGAS37836_02086) | - | 1005452..1006237 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS37836_RS05070 (MGAS37836_02088) | - | 1006364..1006978 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS37836_RS05080 (MGAS37836_02092) | prx | 1007569..1007757 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS37836_RS05085 (MGAS37836_02094) | speA | 1007977..1008732 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS37836_RS05090 (MGAS37836_02096) | - | 1008854..1009513 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS37836_RS05095 (MGAS37836_02098) | - | 1009513..1009734 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS37836_RS05100 (MGAS37836_02100) | - | 1009744..1010517 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS37836_RS05105 (MGAS37836_02102) | - | 1010528..1011130 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS37836_RS05110 (MGAS37836_02104) | - | 1011142..1011906 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS37836_RS05115 (MGAS37836_02106) | - | 1011908..1012240 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS37836_RS05120 (MGAS37836_02108) | - | 1012240..1012563 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS37836_RS05125 (MGAS37836_02110) | - | 1012577..1012699 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS37836_RS05130 (MGAS37836_02112) | - | 1012713..1013060 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS37836_RS05135 (MGAS37836_02114) | - | 1013071..1014933 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS37836_RS05140 (MGAS37836_02116) | - | 1014938..1018378 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS37836_RS05145 (MGAS37836_02118) | - | 1018379..1019863 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS37836_RS05150 (MGAS37836_02120) | - | 1019864..1021669 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS37836_RS05155 (MGAS37836_02122) | - | 1021662..1022120 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS37836_RS05160 (MGAS37836_02124) | - | 1022093..1022410 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS37836_RS05165 (MGAS37836_02126) | - | 1022423..1022929 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS37836_RS05170 (MGAS37836_02128) | - | 1022941..1023351 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS37836_RS05175 (MGAS37836_02130) | - | 1023353..1023748 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS37836_RS05180 (MGAS37836_02132) | - | 1023745..1024056 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS37836_RS05185 (MGAS37836_02134) | - | 1024053..1024397 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS37836_RS05190 (MGAS37836_02136) | - | 1024411..1024704 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS37836_RS05195 (MGAS37836_02138) | - | 1024717..1025607 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS37836_RS05200 (MGAS37836_02140) | - | 1025626..1026195 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS37836_RS05205 (MGAS37836_02142) | - | 1026304..1026438 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS37836_RS05210 (MGAS37836_02144) | - | 1026440..1026709 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS37836_RS05215 (MGAS37836_02146) | - | 1026716..1027624 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS37836_RS05220 (MGAS37836_02148) | - | 1027593..1028918 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS37836_RS05225 (MGAS37836_02150) | - | 1028918..1030192 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS37836_RS05230 (MGAS37836_02152) | - | 1030182..1030562 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS37836_RS05235 (MGAS37836_02154) | - | 1031172..1031606 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS37836_RS05240 (MGAS37836_02156) | - | 1031892..1032158 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS37836_RS05245 (MGAS37836_02158) | - | 1032155..1032679 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS37836_RS05250 (MGAS37836_02160) | - | 1032682..1033314 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS37836_RS05255 (MGAS37836_02162) | - | 1033316..1033600 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS37836_RS05260 (MGAS37836_02164) | - | 1033597..1033767 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS37836_RS05265 (MGAS37836_02166) | - | 1033764..1034000 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS37836_RS05270 (MGAS37836_02168) | - | 1034000..1034245 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS37836_RS05275 (MGAS37836_02170) | - | 1034242..1034598 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS37836_RS05280 (MGAS37836_02172) | - | 1034595..1035035 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS37836_RS05285 | - | 1035035..1035238 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS37836_RS05290 (MGAS37836_02174) | ssb | 1035244..1035669 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS37836_RS05295 (MGAS37836_02176) | - | 1035662..1036336 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS37836_RS05300 (MGAS37836_02178) | - | 1036337..1036819 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS37836_RS05305 (MGAS37836_02180) | - | 1036841..1037095 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS37836_RS05310 (MGAS37836_02182) | - | 1037076..1037429 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS37836_RS05315 (MGAS37836_02186) | - | 1037570..1038352 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS37836_RS05320 (MGAS37836_02188) | - | 1038339..1039169 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS37836_RS05325 | - | 1039183..1039371 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| MGAS37836_RS05330 | - | 1039605..1039844 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS37836_RS05335 (MGAS37836_02192) | - | 1039975..1040184 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS37836_RS05340 (MGAS37836_02194) | - | 1040294..1040494 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS37836_RS05345 (MGAS37836_02196) | - | 1040568..1040954 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS37836_RS05350 (MGAS37836_02198) | - | 1040943..1041152 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS37836_RS05355 (MGAS37836_02200) | - | 1041206..1041805 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS37836_RS05360 (MGAS37836_02202) | - | 1041835..1041993 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS37836_RS05365 (MGAS37836_02206) | - | 1042350..1043174 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37836_RS05370 (MGAS37836_02208) | - | 1043210..1044103 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS37836_RS05375 | - | 1044224..1045312 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS37836_RS05380 (MGAS37836_02214) | - | 1045675..1046295 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=977769 MGAS37836_RS05080 WP_011285559.1 1007569..1007757(-) (prx) [Streptococcus pyogenes strain MGAS37836]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=977769 MGAS37836_RS05080 WP_011285559.1 1007569..1007757(-) (prx) [Streptococcus pyogenes strain MGAS37836]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |