Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS37839_RS07180 | Genome accession | NZ_CP151453 |
| Coordinates | 1408774..1408953 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS37839 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408774..1449390 | 1408774..1408953 | within | 0 |
Gene organization within MGE regions
Location: 1408774..1449390
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37839_RS07180 (MGAS37839_02948) | prx | 1408774..1408953 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS37839_RS07185 (MGAS37839_02950) | sda1 | 1409192..1410364 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| MGAS37839_RS07190 (MGAS37839_02952) | - | 1410480..1411676 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS37839_RS07195 (MGAS37839_02956) | - | 1411787..1411972 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS37839_RS07200 (MGAS37839_02958) | - | 1411969..1412268 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS37839_RS07205 (MGAS37839_02960) | - | 1412279..1412899 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS37839_RS07210 (MGAS37839_02962) | - | 1412902..1413063 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS37839_RS07215 (MGAS37839_02964) | - | 1413072..1414979 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS37839_RS07220 (MGAS37839_02966) | - | 1414990..1415625 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS37839_RS07225 (MGAS37839_02968) | - | 1415625..1416680 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS37839_RS07230 (MGAS37839_02970) | - | 1416677..1418659 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS37839_RS07235 (MGAS37839_02972) | - | 1418669..1419511 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS37839_RS07240 (MGAS37839_02974) | - | 1419523..1423905 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS37839_RS07245 (MGAS37839_02976) | - | 1423920..1424153 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS37839_RS07250 (MGAS37839_02978) | - | 1424228..1424683 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS37839_RS07255 (MGAS37839_02980) | - | 1424737..1425336 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS37839_RS07260 (MGAS37839_02982) | - | 1425348..1425707 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS37839_RS07265 (MGAS37839_02984) | - | 1425711..1426055 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS37839_RS07270 (MGAS37839_02986) | - | 1426052..1426330 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS37839_RS07275 (MGAS37839_02988) | - | 1426341..1426697 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS37839_RS07280 (MGAS37839_02990) | - | 1426709..1427596 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS37839_RS07285 (MGAS37839_02992) | - | 1427609..1428178 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS37839_RS07290 (MGAS37839_02994) | - | 1428334..1428600 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS37839_RS07295 | - | 1428603..1428791 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS37839_RS07300 (MGAS37839_02998) | - | 1428822..1430267 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS37839_RS07305 (MGAS37839_03000) | - | 1430227..1431759 (-) | 1533 | WP_076639992.1 | phage portal protein | - |
| MGAS37839_RS07310 (MGAS37839_03002) | - | 1431775..1433052 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS37839_RS07315 (MGAS37839_03004) | - | 1433042..1433494 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS37839_RS07320 (MGAS37839_03006) | - | 1433584..1434000 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS37839_RS07325 (MGAS37839_03008) | - | 1433997..1434188 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS37839_RS07330 (MGAS37839_03010) | - | 1434178..1435029 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| MGAS37839_RS07335 (MGAS37839_03012) | - | 1435038..1435304 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS37839_RS07340 (MGAS37839_03014) | - | 1435301..1435468 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS37839_RS07345 (MGAS37839_03016) | - | 1435469..1436791 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS37839_RS07350 (MGAS37839_03018) | - | 1436788..1437063 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| MGAS37839_RS07355 (MGAS37839_03020) | - | 1437450..1439834 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS37839_RS07360 (MGAS37839_03022) | - | 1439839..1441761 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| MGAS37839_RS07365 (MGAS37839_03024) | - | 1441804..1442361 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS37839_RS07370 (MGAS37839_03026) | - | 1442372..1442770 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS37839_RS07375 (MGAS37839_03028) | - | 1442774..1443928 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS37839_RS07380 (MGAS37839_03030) | - | 1443928..1444227 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS37839_RS07385 (MGAS37839_03032) | - | 1444315..1444518 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS37839_RS07390 (MGAS37839_03036) | - | 1444664..1445050 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS37839_RS07395 (MGAS37839_03038) | - | 1445047..1445250 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS37839_RS07400 (MGAS37839_03040) | - | 1445243..1445413 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS37839_RS07405 (MGAS37839_03042) | - | 1445410..1445685 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS37839_RS07410 (MGAS37839_03044) | - | 1445747..1445962 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS37839_RS07415 (MGAS37839_03046) | - | 1446010..1446423 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| MGAS37839_RS07420 (MGAS37839_03048) | - | 1446404..1446559 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| MGAS37839_RS07425 (MGAS37839_03050) | - | 1446885..1447235 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS37839_RS07430 (MGAS37839_03052) | - | 1447249..1447632 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS37839_RS07435 (MGAS37839_03054) | - | 1447643..1448194 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS37839_RS07440 (MGAS37839_03056) | - | 1448311..1449390 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=977668 MGAS37839_RS07180 WP_002988813.1 1408774..1408953(-) (prx) [Streptococcus pyogenes strain MGAS37839]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=977668 MGAS37839_RS07180 WP_002988813.1 1408774..1408953(-) (prx) [Streptococcus pyogenes strain MGAS37839]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |